DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and EFE

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_171994.1 Gene:EFE / 839345 AraportID:AT1G05010 Length:323 Species:Arabidopsis thaliana


Alignment Length:314 Identity:75/314 - (23%)
Similarity:124/314 - (39%) Gaps:97/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PIIDLE--NTIEDVAT--NLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFER 75
            |||:||  |..|...|  .:::|....|:...:|||||.|.:.|..|       :|.|       
plant     5 PIINLEKLNGEERAITMEKIKDACENWGFFECVNHGISLELLDKVEK-------MTKE------- 55

  Fly    76 SKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRHINSLVDDFNEL--- 137
                                       | |..| ::::|....:    :|.::||..:.|::   
plant    56 ---------------------------H-YKKC-MEERFKESIK----NRGLDSLRSEVNDVDWE 87

  Fly   138 GRFILKALAIS-LDAPPSFFTDKHSFM---------LSDDRFNLTT---------LRMLF----- 178
            ..|.||.|.:| :...|....|..:.|         ||::..:|..         |:.:|     
plant    88 STFYLKHLPVSNISDVPDLDDDYRTLMKDFAGKIEKLSEELLDLLCENLGLEKGYLKKVFYGSKR 152

  Fly   179 ---------YPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGA 233
                     |||..:.|..:..   .||.|.....||.||.: .||::...|  :|..|..:..:
plant   153 PTFGTKVSNYPPCPNPDLVKGL---RAHTDAGGIILLFQDDKVSGLQLLKDG--EWVDVPPVKHS 212

  Fly   234 LFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            :.:|.|:.:.:.|:..|.:::|||:  .|.|  ..||.|||.|.:|.:.::|.|
plant   213 IVVNLGDQLEVITNGKYKSVEHRVL--SQTD--GEGRMSIASFYNPGSDSVIFP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 74/312 (24%)
DIOX_N 14..107 CDD:290926 22/95 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 31/100 (31%)
EFENP_171994.1 PLN02299 1..323 CDD:215168 75/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.