DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and 2A6

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_171840.2 Gene:2A6 / 838763 AraportID:AT1G03410 Length:398 Species:Arabidopsis thaliana


Alignment Length:365 Identity:82/365 - (22%)
Similarity:128/365 - (35%) Gaps:129/365 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETETLLLQNA-------VPIIDLENTIED------VATNLREALSEKGYALLINHGISNEKIKKA 55
            :|.|.|.|.|       :|.:||:....|      |...:.:|....|:..::|||||.|     
plant    77 DTLTSLKQTAPPSQQLTIPTVDLKGGSMDLISRRSVVEKIGDAAERWGFFQVVNHGISVE----- 136

  Fly    56 WKYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELR------------------ 102
                            ..||.|           .|:.||..:.||::                  
plant   137 ----------------VMERMK-----------EGIRRFHEQDPEVKKRFYSRDHTRDVLYYSNI 174

  Fly   103 --HAYN---------IC-------KLQDKFLPE---QQLPGFSRHINSLVDDFNELGRFILKALA 146
              |..|         .|       ||||  ||.   :.:..:|:.:.:       ||.|:.:.|:
plant   175 DLHTCNKAANWRDTLACYMAPDPPKLQD--LPAVCGEIMMEYSKQLMT-------LGEFLFELLS 230

  Fly   147 ISLDAPPSFFTD----KHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLA 207
            .:|...|:...|    |...|...           :|||....|   ..:....|.|:...|:|.
plant   231 EALGLNPNHLKDMGCAKSHIMFGQ-----------YYPPCPQPD---LTLGISKHTDFSFITILL 281

  Fly   208 QDSEGGLEVKLRGSDK-WERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRH 271
            ||:.|||:|.   .|: |..|..:||||.||.|:.:.:.::..:.:.:|||:.....:.|.....
plant   282 QDNIGGLQVI---HDQCWVDVSPVPGALVINIGDLLQLISNDKFISAEHRVIANGSSEPRISMPC 343

  Fly   272 SIAYFCHPDNSALINP-------------KDLNITTKQTT 298
            .::.|..| |..:..|             :||.||....|
plant   344 FVSTFMKP-NPRIYGPIKELLSEQNPAKYRDLTITEFSNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 72/330 (22%)
DIOX_N 14..107 CDD:290926 23/127 (18%)
2OG-FeII_Oxy 179..279 CDD:281202 29/100 (29%)
2A6NP_171840.2 PLN02393 57..386 CDD:215220 82/365 (22%)
DIOX_N 94..199 CDD:290926 24/136 (18%)
2OG-FeII_Oxy 255..345 CDD:281202 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.010

Return to query results.
Submit another query.