DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and SRG1

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_173145.1 Gene:SRG1 / 838272 AraportID:AT1G17020 Length:358 Species:Arabidopsis thaliana


Alignment Length:279 Identity:74/279 - (26%)
Similarity:121/279 - (43%) Gaps:41/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDLE-----NTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAF 73
            :||||::     .|::.....|..|..|.|:..|:||||.:..:.|.......|.:|..|.|..|
plant    53 IPIIDMKRLCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKF 117

  Fly    74 -ERSKAPDGENHGYVSPGMERFDG--------RTPELRHAYNICKLQDKFLPEQQLPGFSRHINS 129
             :|....:|....:|....::.|.        :..|||..:        ..|:..|| |...:..
plant   118 WQRPDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPH--------LFPKLPLP-FRDTLEM 173

  Fly   130 LVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIRC 194
            ...:...:.:.::..:|.:|:..|     :....|.||..::.::||.:|||....|   ..|..
plant   174 YSSEVQSVAKILIAKMARALEIKP-----EELEKLFDDVDSVQSMRMNYYPPCPQPD---QVIGL 230

  Fly   195 GAHADYCTFTLLAQ--DSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRV 257
            ..|:|....|:|.|  |.| ||::|..|  ||..|..||.|..:|.|:.:.|.|:..|.:::||.
plant   231 TPHSDSVGLTVLMQVNDVE-GLQIKKDG--KWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRG 292

  Fly   258 VIPDQVDIRHRGRHSIAYF 276
            |:..:     :.|.|||.|
plant   293 VVNSE-----KERLSIATF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 74/279 (27%)
DIOX_N 14..107 CDD:290926 27/106 (25%)
2OG-FeII_Oxy 179..279 CDD:281202 35/100 (35%)
SRG1NP_173145.1 PLN02216 1..358 CDD:215129 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.