DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G17010

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_173144.1 Gene:AT1G17010 / 838271 AraportID:AT1G17010 Length:361 Species:Arabidopsis thaliana


Alignment Length:305 Identity:74/305 - (24%)
Similarity:127/305 - (41%) Gaps:44/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSETETLL----LQNAVPIIDLENTIEDVATN-----LREALSEKGYALLINHGISNEKIKKAWK 57
            :.:||.::    |.:.:||||:.......|.:     |..|..|.|:..|:||||....:.|...
plant    38 QDKTEVVVHDSGLISEIPIIDMNRLCSSTAVDSEVEKLDFACKEYGFFQLVNHGIDPSFLDKIKS 102

  Fly    58 YFDGFVDL-TDEVKLAFERSKAPDGENHGYVSPGMERFDG--------RTPELRHAYNICKLQDK 113
            ....|.:| .:|.|..::.....:|....:|....::.|.        :..:||..:...||...
plant   103 EIQDFFNLPMEEKKKLWQTPAVMEGFGQAFVVSEDQKLDWADLFFLIMQPVQLRKRHLFPKLPLP 167

  Fly   114 FLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLF 178
            |  ...|..:|..:.|       :.:.:|..:|.:|...|    ::...:..||.  :.::||.:
plant   168 F--RDTLDMYSTRVKS-------IAKILLAKMAKALQIKP----EEVEEIFGDDM--MQSMRMNY 217

  Fly   179 YPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGETM 242
            |||....:.....|   .|:|....|:|.|.:| .||::|..|  ||..|..|..|..:|.|:.:
plant   218 YPPCPQPNLVTGLI---PHSDAVGLTILLQVNEVDGLQIKKNG--KWFFVKPLQNAFIVNVGDVL 277

  Fly   243 AIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            .|.|:..|.:::||.::.     ..:.|.|||.|.:......|.|
plant   278 EIITNGTYRSIEHRAMVN-----LEKERLSIATFHNTGMDKEIGP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 70/288 (24%)
DIOX_N 14..107 CDD:290926 24/106 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 31/100 (31%)
AT1G17010NP_173144.1 PLN02216 1..358 CDD:215129 74/305 (24%)
DIOX_N 54..163 CDD:290926 24/108 (22%)
2OG-FeII_Oxy 211..308 CDD:281202 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.