DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G14120

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001322167.1 Gene:AT1G14120 / 837971 AraportID:AT1G14120 Length:312 Species:Arabidopsis thaliana


Alignment Length:302 Identity:73/302 - (24%)
Similarity:115/302 - (38%) Gaps:65/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQNAVPIIDLENTIEDVAT-NLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKL-- 71
            :...:|.||||...:.:.. .:|||....|...:||||:|...:.:..|......:...|:||  
plant     4 VNGVIPTIDLEEVNDQILNEKIREASERWGCFTVINHGVSLSLMAEMKKTVRDLHERPYEMKLRN 68

  Fly    72 ---AFERSKAPDGE-NHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQ--LPGFSRHINSL 130
               .......|..| |..|.|.|:  ||..:|:..:::  |...|. .|:|:  |..:::    .
plant    69 TDVLLGNGYKPLSEFNPFYESFGL--FDMASPQAVNSF--CDKLDA-SPDQREILLKYAK----A 124

  Fly   131 VDDFNELGRFILKALAISLDA---------PPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQD 186
            .||   |.|.:.:.||.|...         |..|..:|:.|. .|....|..:            
plant   125 TDD---LARSLARRLAESYGVVEPNFLRGWPSQFRMNKYHFK-PDSVGKLGVI------------ 173

  Fly   187 HGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFY 250
                     .|.|....|:|..|.: ||||.....|..:..:..||..|.:|.|:...||::...
plant   174 ---------LHTDPGFLTILQGDEDVGGLEAMDNSSGSFFPIHTLPNTLLVNLGDMATIWSNGRL 229

  Fly   251 HALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNI 292
            ..::|||..     |..:.|.:||.|       |:.|.|.::
plant   230 CNVKHRVQC-----IEAKMRITIASF-------LLGPVDRDL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/292 (24%)
DIOX_N 14..107 CDD:290926 27/99 (27%)
2OG-FeII_Oxy 179..279 CDD:281202 25/100 (25%)
AT1G14120NP_001322167.1 PLN02365 1..304 CDD:177993 73/302 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.