DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G12010

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_172665.1 Gene:AT1G12010 / 837753 AraportID:AT1G12010 Length:320 Species:Arabidopsis thaliana


Alignment Length:340 Identity:77/340 - (22%)
Similarity:125/340 - (36%) Gaps:91/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PIIDL-----ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDE-----V 69
            |:|||     |...:.:|. :.:|....|:..|:|||:       .:...|....:|.|     :
plant     8 PVIDLSKLNGEERDQTMAL-IDDACQNWGFFELVNHGL-------PYDLMDNIERMTKEHYKKHM 64

  Fly    70 KLAFE---RSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQL---PGFSRHIN 128
            :..|:   |||..|     .:...:|..|..:....|          .||:..|   |..|....
plant    65 EQKFKEMLRSKGLD-----TLETEVEDVDWESTFYLH----------HLPQSNLYDIPDMSNEYR 114

  Fly   129 SLVDDFNE----LGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTT-----LRMLFYPPVED 184
            ..:.||.:    |...:|..|..:|.....:....         |:.||     .::..|||...
plant   115 LAMKDFGKRLEILAEELLDLLCENLGLEKGYLKKV---------FHGTTGPTFATKLSNYPPCPK 170

  Fly   185 QDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQ 248
            .:..:..   .||.|.....||.||.: .||:: |:..| |..|..|..::.||.|:.:.:.|:.
plant   171 PEMIKGL---RAHTDAGGLILLFQDDKVSGLQL-LKDGD-WVDVPPLKHSIVINLGDQLEVITNG 230

  Fly   249 FYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP------KD-----------------L 290
            .|.::.|||:..     :...|.|||.|.:|.:.|.|:|      ||                 |
plant   231 KYKSVMHRVMTQ-----KEGNRMSIASFYNPGSDAEISPATSLVDKDSKYPSFVFDDYMKLYAGL 290

  Fly   291 NITTKQTTSDVIQNA 305
            ....|:...:.::||
plant   291 KFQAKEPRFEAMKNA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 70/297 (24%)
DIOX_N 14..107 CDD:290926 23/104 (22%)
2OG-FeII_Oxy 179..279 CDD:281202 30/100 (30%)
AT1G12010NP_172665.1 PLN02299 1..317 CDD:215168 77/340 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.