DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT5G58660

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_200674.1 Gene:AT5G58660 / 835980 AraportID:AT5G58660 Length:352 Species:Arabidopsis thaliana


Alignment Length:316 Identity:77/316 - (24%)
Similarity:132/316 - (41%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKL-AFERSK 77
            :|:||||...:::   ||||..|.|...|.|||:......:..:..:..:.|..|.|. .|...|
plant    34 IPVIDLERLDKEI---LREACKEWGIFRLENHGVPLALTSRLQEISESLLSLPFEKKRELFAAVK 95

  Fly    78 APDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSR-HINSLVDD-------- 133
            :|  .::.:.:|.:.|..........|.|:..|:...:|...|...|: ..::..||        
plant    96 SP--LSYFWGTPALNRSGDALKRGAQASNLTMLEGFNVPLSSLSSLSKLPTSTCCDDDAQEEPKL 158

  Fly   134 ------FNELGRFI-------LKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQ 185
                  ..|.|:.|       .:|:|.:|:...|  .::.|..||:.    |.|..::..|...:
plant   159 ESFRVLMEEYGKHITRIAVSLFEAIAQTLNLELS--GNRRSEYLSES----TGLIRVYRYPQSSE 217

  Fly   186 DHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFY 250
            :..|..:....|.|....::|.:|..||||: ::| ::|..|..:...|.:|.|:.|...:|..|
plant   218 EAAREALGMEVHTDSSVISILREDESGGLEI-MKG-EEWFCVKPVANTLIVNLGDMMQAISDDEY 280

  Fly   251 HALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITT-----KQTTSDV 301
            .::.|||    :...|...|||:.||..|....:|...:..:.|     .|..:||
plant   281 KSVTHRV----KKRNRKTERHSVCYFVFPKRDCVIKSSNYKLFTYSDFEAQVQADV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 73/295 (25%)
DIOX_N 14..107 CDD:290926 24/93 (26%)
2OG-FeII_Oxy 179..279 CDD:281202 28/99 (28%)
AT5G58660NP_200674.1 PLN02984 1..348 CDD:215534 77/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.