DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT5G43450

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_199158.1 Gene:AT5G43450 / 834365 AraportID:AT5G43450 Length:362 Species:Arabidopsis thaliana


Alignment Length:332 Identity:86/332 - (25%)
Similarity:136/332 - (40%) Gaps:70/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQNAVPIIDL--ENTIED--VATNLREALSEKGYALLINHGIS---NEKIKKAWKYFDGFVDLTD 67
            |...||||||  .||...  |.:.:::|....|:..:|||.:.   .|:||::.:.|       .
plant    57 LNLTVPIIDLGDRNTSSRNVVISKIKDAAENWGFFQVINHDVPLTVLEEIKESVRRF-------H 114

  Fly    68 EVKLAFERSKAPDGENHGYV-SPGMERFDGRTPELRHAYNICKLQDKFLPEQQLP--------GF 123
            |.....:....|...|..:| :...:.:.......|.::......|...|| ::|        .:
plant   115 EQDPVVKNQYLPTDNNKRFVYNNDFDLYHSSPLNWRDSFTCYIAPDPPNPE-EIPLACRSAVIEY 178

  Fly   124 SRHINSLVDDFNELGRFILKAL--AISLDAPPSFFTD--KHSFMLSDDRFNLTTLRMLFYPPVED 184
            ::|:       .|||..:.:.|  |:.||:......|  |..|||..           :|||...
plant   179 TKHV-------MELGAVLFQLLSEALGLDSETLKRIDCLKGLFMLCH-----------YYPPCPQ 225

  Fly   185 QDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQF 249
            .|   ..:....|.|....|||.||..|||:|  ...|.|..|..:||||.:|.|:.|.:.|:..
plant   226 PD---LTLGISKHTDNSFLTLLLQDQIGGLQV--LHEDYWVDVPPVPGALVVNIGDFMQLITNDK 285

  Fly   250 YHALQHRVVIPDQVDIRHRGRHSIAYFCHPD---NSALINP-KDL----------NITTKQTTSD 300
            :.:::|| |.|:    :.|.|.|:|.|....   ||.:..| |||          :||..:.|:.
plant   286 FLSVEHR-VRPN----KDRPRISVACFFSSSLSPNSTVYGPIKDLLSDENPAKYKDITIPEYTAG 345

  Fly   301 VIQNAYD 307
            .:.:.:|
plant   346 FLASIFD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 77/296 (26%)
DIOX_N 14..107 CDD:290926 23/100 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 35/99 (35%)
AT5G43450NP_199158.1 PLN02912 37..360 CDD:178500 86/332 (26%)
DIOX_N 61..169 CDD:290926 26/115 (23%)
2OG-FeII_Oxy 215..308 CDD:281202 36/113 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.010

Return to query results.
Submit another query.