DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT5G20550

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_197555.1 Gene:AT5G20550 / 832177 AraportID:AT5G20550 Length:349 Species:Arabidopsis thaliana


Alignment Length:314 Identity:91/314 - (28%)
Similarity:131/314 - (41%) Gaps:71/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQNAVPIIDL------------ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGF 62
            |..|||::|:            ::..|:: :.|..|||..|...:|||||:...:.|.:|....|
plant    36 LNAAVPVMDIPAIDLSLLLSPSDDGREEL-SKLHSALSTWGVVQVINHGITKALLDKIYKLTKEF 99

  Fly    63 VDLTDEVKLAFERSKAPDGENHGY----------VSPGMERFDGRT-PELRHAYNICKLQDKFLP 116
            ..|..|.|..:.|.   .|...||          |...::|....| ||.:.       |.||.|
plant   100 CALPSEEKQKYARE---IGSIQGYGNDMILWDDQVLDWIDRLYITTYPEDQR-------QLKFWP 154

  Fly   117 EQQLPGFSRHINS------LVDDFNELGRFILKALAISLDAPPSFFTD---KHSFMLSDDRFNLT 172
            :..: ||...::.      ||  ||:    :.||:||||:...:.|.|   :::.|  |.|||: 
plant   155 DVPV-GFRETLHEYTMKQHLV--FNQ----VFKAMAISLELEENCFLDMCGENATM--DTRFNM- 209

  Fly   173 TLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPG-ALF 235
                  |||....|   ..|....|||...||||..|.. .||:....|  ||.:...:.. .:.
plant   210 ------YPPCPRPD---KVIGVRPHADKSAFTLLLPDKNVEGLQFLKDG--KWYKAPVVASDTIL 263

  Fly   236 INCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKD 289
            ||.|:.|.|.::..|.:..||||...:     :.|.|:|.||.|.....|.|.|
plant   264 INVGDQMEIMSNGIYKSPVHRVVTNTE-----KERISVATFCIPGADKEIQPVD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 88/307 (29%)
DIOX_N 14..107 CDD:290926 29/115 (25%)
2OG-FeII_Oxy 179..279 CDD:281202 33/101 (33%)
AT5G20550NP_197555.1 PLN00417 1..349 CDD:177810 91/314 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.