DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and FLS1

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001190266.1 Gene:FLS1 / 830765 AraportID:AT5G08640 Length:336 Species:Arabidopsis thaliana


Alignment Length:291 Identity:65/291 - (22%)
Similarity:119/291 - (40%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDLENTIED-VATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFERS 76
            |:|::||.:..|: |...:.:|..|.|...::||||..|.|::.......|.:|....|.:.  :
plant    42 AIPVVDLSDPDEESVRRAVVKASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEKESV--A 104

  Fly    77 KAPDGEN-HGYVSPGMERFDGRTPELRHAYN-----ICKLQDKFLPEQQLPGFSRHINS----LV 131
            |..|.:: .||.:...:..:|:...:.|.::     .| :..:|.|:.  |...|.:|.    .|
plant   105 KPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSC-VNYRFWPKN--PPEYREVNEEYAVHV 166

  Fly   132 DDFNE--LGRFILKALAISLDA-PPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIR 193
            ...:|  || .:...|.:..|| ......:...:|          :::.:|||....|     :.
plant   167 KKLSETLLG-ILSDGLGLKRDALKEGLGGEMAEYM----------MKINYYPPCPRPD-----LA 215

  Fly   194 CG--AHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHR 256
            .|  ||.|....|||..:...||:|  ...|.|....::|.|:.::.|:.:...::..|..:.||
plant   216 LGVPAHTDLSGITLLVPNEVPGLQV--FKDDHWFDAEYIPSAVIVHIGDQILRLSNGRYKNVLHR 278

  Fly   257 VVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            ..:.     :.:.|.|...|..|....::.|
plant   279 TTVD-----KEKTRMSWPVFLEPPREKIVGP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 64/289 (22%)
DIOX_N 14..107 CDD:290926 23/99 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 25/101 (25%)
FLS1NP_001190266.1 PLN02704 1..335 CDD:166345 65/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.