DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA20OX3

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_196337.1 Gene:GA20OX3 / 830611 AraportID:AT5G07200 Length:380 Species:Arabidopsis thaliana


Alignment Length:314 Identity:85/314 - (27%)
Similarity:137/314 - (43%) Gaps:56/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSETETLLLQNAVPIIDL------ENTIEDVATNL-REALSEKGYALLINHGISNEKIKKAWKYF 59
            |..|:...||  ||:|||      ::.:...||.| .:|.::.|:.|:.|||:....:.:|:.:.
plant    48 KPSTDVQPLQ--VPLIDLAGFLSGDSCLASEATRLVSKAATKHGFFLITNHGVDESLLSRAYLHM 110

  Fly    60 DGFVDLTDEVKLAFERSKAPD--GENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPG 122
            |.|....     |.|:.||..  ||:.||.|..:.||..:.|...      .|..||.||:::..
plant   111 DSFFKAP-----ACEKQKAQRKWGESSGYASSFVGRFSSKLPWKE------TLSFKFSPEEKIHS 164

  Fly   123 ------FSRHINSLVDDF-----------NELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFN 170
                  .|:.:....:||           |.|...|::.|.:||.....:|  |..|..||..| 
plant   165 QTVKDFVSKKMGDGYEDFGKVYQEYAEAMNTLSLKIMELLGMSLGVERRYF--KEFFEDSDSIF- 226

  Fly   171 LTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALF 235
                |:.:||..:..:..   :..|.|.|..:.|:|.||..|||:|.:  .:||:.:...|.|..
plant   227 ----RLNYYPQCKQPELA---LGTGPHCDPTSLTILHQDQVGGLQVFV--DNKWQSIPPNPHAFV 282

  Fly   236 INCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKD 289
            :|.|:|....|:..|.:..||.|:..:     |.|.:.|:|..|....::.|.:
plant   283 VNIGDTFMALTNGRYKSCLHRAVVNSE-----RERKTFAFFLCPKGEKVVKPPE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 80/299 (27%)
DIOX_N 14..107 CDD:290926 29/101 (29%)
2OG-FeII_Oxy 179..279 CDD:281202 29/99 (29%)
GA20OX3NP_196337.1 PLN02276 17..380 CDD:215156 85/314 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2612
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.