DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT5G05600

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_196179.1 Gene:AT5G05600 / 830443 AraportID:AT5G05600 Length:371 Species:Arabidopsis thaliana


Alignment Length:313 Identity:76/313 - (24%)
Similarity:130/313 - (41%) Gaps:53/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TETLLLQNAVPIIDLENTIED-------VATNLREALSEKGYALLINHGISNEKIKKAWKYFDGF 62
            ||.......:||||||....:       :...:.||....|:..::|||:..|.:..|.:.:..|
plant    53 TEDAPTATNIPIIDLEGLFSEEGLSDDVIMARISEACRGWGFFQVVNHGVKPELMDAARENWREF 117

  Fly    63 VDLTDEVKLAFERSKAPDGENHGYVSP-GMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRH 126
            ..:....|..:..|..   ...||.|. |:|:  |.:.:....|.:..|........:.|.|...
plant   118 FHMPVNAKETYSNSPR---TYEGYGSRLGVEK--GASLDWSDYYFLHLLPHHLKDFNKWPSFPPT 177

  Fly   127 INSLVDDFNE----LGRFILKALAISLDAPPSFFTDKHSFMLSDDRF-------NL-TTLRMLFY 179
            |..::|::.|    |...|::.|:.:|.             |.:|:|       |: ..||:.:|
plant   178 IREVIDEYGEELVKLSGRIMRVLSTNLG-------------LKEDKFQEAFGGENIGACLRVNYY 229

  Fly   180 P--PVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGET 241
            |  |..:...|.|     .|:|....|:|..|.: .||:|  |..|.|..|...|.|..:|.|:.
plant   230 PKCPRPELALGLS-----PHSDPGGMTILLPDDQVFGLQV--RKDDTWITVKPHPHAFIVNIGDQ 287

  Fly   242 MAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITT 294
            :.|.::..|.:::|||::...     :.|.|:|:|.:|.:...|.|....::|
plant   288 IQILSNSTYKSVEHRVIVNSD-----KERVSLAFFYNPKSDIPIQPLQELVST 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 72/296 (24%)
DIOX_N 14..107 CDD:290926 24/100 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 30/102 (29%)
AT5G05600NP_196179.1 PLN02393 13..371 CDD:215220 76/313 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.