DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA20OX1

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_194272.1 Gene:GA20OX1 / 828645 AraportID:AT4G25420 Length:377 Species:Arabidopsis thaliana


Alignment Length:330 Identity:83/330 - (25%)
Similarity:141/330 - (42%) Gaps:43/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQNAVPIIDLENTIEDVATNL------REALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTD 67
            :|:..||:|||:|.:.|.::.|      .||..:.|:.|::|||||.|.|..|.:|...|.|:..
plant    56 VLELDVPLIDLQNLLSDPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPL 120

  Fly    68 EVKLAFERSKAPDGENHGYVSPGMERFDGRTP-ELRHAYNIC-------KLQDKFLPE--QQLPG 122
            ..|   :|.....||:.||.|....||..:.| :...::..|       .:||.|...  .....
plant   121 SEK---QRVLRKSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQP 182

  Fly   123 FSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDH 187
            |.:......:..:.|...|::.|.:||.....:|.:   |...:|    :.:|:.:|||....| 
plant   183 FGKVYQEYCEAMSSLSLKIMELLGLSLGVKRDYFRE---FFEEND----SIMRLNYYPPCIKPD- 239

  Fly   188 GRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHA 252
              ..:..|.|.|..:.|:|.||...||:|.:  .::|..:...|.|..:|.|:|....::..|.:
plant   240 --LTLGTGPHCDPTSLTILHQDHVNGLQVFV--ENQWRSIRPNPKAFVVNIGDTFMALSNDRYKS 300

  Fly   253 LQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSDVIQNAY-DITMALAKGA 316
            ..||.|:..:.:     |.|:|:|..|....::.|      .::....:....| |.|.::....
plant   301 CLHRAVVNSESE-----RKSLAFFLCPKKDRVVTP------PRELLDSITSRRYPDFTWSMFLEF 354

  Fly   317 FAHHY 321
            ...||
plant   355 TQKHY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 76/289 (26%)
DIOX_N 14..107 CDD:290926 33/99 (33%)
2OG-FeII_Oxy 179..279 CDD:281202 28/99 (28%)
GA20OX1NP_194272.1 PLN02276 22..373 CDD:215156 83/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2450
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.