DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G25300

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_194260.1 Gene:AT4G25300 / 828633 AraportID:AT4G25300 Length:356 Species:Arabidopsis thaliana


Alignment Length:287 Identity:71/287 - (24%)
Similarity:121/287 - (42%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQNAVPIIDL-----ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDL-TDE 68
            |:|.:||||:     ..:::.....|..|..|.|:..|:|||:.:..:.|.......|.:| .:|
plant    48 LRNQIPIIDMSLLCSSTSMDSEIDKLDSACKEWGFFQLVNHGMESSFLNKVKSEVQDFFNLPMEE 112

  Fly    69 VKLAFERSKAPDGENHGYVSPGMERFDG-------------RTPELRHAYNICKLQDKFLPEQQL 120
            .|..:::....:|....:|....::.|.             |.|.|             .|:..|
plant   113 KKNLWQQPDEIEGFGQVFVVSEEQKLDWADMFFLTMQPVRLRKPHL-------------FPKLPL 164

  Fly   121 PGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQ 185
            | |...::....:...:.:.:|..:|::|...|... ||    |.||... ..:|:.:||...:.
plant   165 P-FRDTLDMYSAEVKSIAKILLGKIAVALKIKPEEM-DK----LFDDELG-QRIRLNYYPRCPEP 222

  Fly   186 DHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQF 249
            |   ..|....|:|....|:|.|.:| .||::|...  ||..|..||.||.:|.|:.:.|.|:..
plant   223 D---KVIGLTPHSDSTGLTILLQANEVEGLQIKKNA--KWVSVKPLPNALVVNVGDILEIITNGT 282

  Fly   250 YHALQHRVVIPDQVDIRHRGRHSIAYF 276
            |.:::||.|:..:     :.|.|:|.|
plant   283 YRSIEHRGVVNSE-----KERLSVAAF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 69/284 (24%)
DIOX_N 14..107 CDD:290926 23/111 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 32/99 (32%)
AT4G25300NP_194260.1 PLN02216 1..356 CDD:215129 71/287 (25%)
DIOX_N 52..161 CDD:290926 23/121 (19%)
2OG-FeII_Oxy 211..306 CDD:281202 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.