DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G23340

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_194065.3 Gene:AT4G23340 / 828433 AraportID:AT4G23340 Length:324 Species:Arabidopsis thaliana


Alignment Length:303 Identity:73/303 - (24%)
Similarity:123/303 - (40%) Gaps:64/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDLENTIE-DVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFERSK 77
            :|::||...|| .:.::|.||..|.|:..:.|||||.|...|       ...|:.:|..|...||
plant    10 LPVLDLTQPIESSILSSLSEACKEWGFFYVTNHGISKEMFSK-------ICSLSRDVFKAPLESK 67

  Fly    78 ---APDGENHGYV-SPGMERFDGRTPELRHAYNICK---LQDKFLPEQQLPGFSRHINSLVDDFN 135
               .|......|: ||..|......|:...:.....   .||...||         :...:.::.
plant    68 LKLGPISYTPRYIASPYFESLVVSGPDFSDSAKASADVLFQDHHKPE---------LRETMQEYG 123

  Fly   136 ----ELGRFILKALAI------------SLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVED 184
                ||.:.::|.|.:            ..|     |::.|.:           ||::.|.|..|
plant   124 AKMAELSKRLIKILLMMTLGDETGKRLYQTD-----FSNCHGY-----------LRLVNYTPPHD 172

  Fly   185 QDHGRSFIR-CGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQ 248
            .:.....:. .|.|.|....|::.|||.|||:::.: ..||..:......|.:|.|:.|..|::.
plant   173 VEKQEELVEGLGMHTDMSCITIVYQDSVGGLQMRSK-EGKWIDINPCNDFLVVNIGDLMQAWSNG 236

  Fly   249 FYHALQHRVVIPDQVDIRHRGRHSIAYF-CHPDNSALINPKDL 290
            ...:.:||||:...|:     |.|:|:| |..|...::.|:::
plant   237 RLRSSEHRVVLRKLVN-----RVSLAFFLCFEDEKVILAPQEI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 72/298 (24%)
DIOX_N 14..107 CDD:290926 28/97 (29%)
2OG-FeII_Oxy 179..279 CDD:281202 30/101 (30%)
AT4G23340NP_194065.3 PcbC 30..268 CDD:226022 65/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.