DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G22870

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001154266.1 Gene:AT4G22870 / 828386 AraportID:AT4G22870 Length:153 Species:Arabidopsis thaliana


Alignment Length:78 Identity:21/78 - (26%)
Similarity:38/78 - (48%) Gaps:13/78 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GLEVK-LRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYF 276
            |:.:| |....||.....:|.::.::.|:|:.|.::..|.::.||.::.     :.:.|.|.|.|
plant    42 GMNLKDLFYEGKWVTAKCVPNSIVMHIGDTLEILSNGKYKSILHRGLVN-----KEKVRISWAVF 101

  Fly   277 CHPDNSALINPKD 289
            |.|       |||
plant   102 CEP-------PKD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 18/74 (24%)
DIOX_N 14..107 CDD:290926
2OG-FeII_Oxy 179..279 CDD:281202 17/66 (26%)
AT4G22870NP_001154266.1 pepsin_retropepsin_like <4..>31 CDD:299705
2OG-FeII_Oxy <48..104 CDD:281202 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.