DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G22870

DIOPT Version :10

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001154266.1 Gene:AT4G22870 / 828386 AraportID:AT4G22870 Length:153 Species:Arabidopsis thaliana


Alignment Length:78 Identity:21/78 - (26%)
Similarity:38/78 - (48%) Gaps:13/78 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GLEVK-LRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYF 276
            |:.:| |....||.....:|.::.::.|:|:.|.::..|.::.||.::.     :.:.|.|.|.|
plant    42 GMNLKDLFYEGKWVTAKCVPNSIVMHIGDTLEILSNGKYKSILHRGLVN-----KEKVRISWAVF 101

  Fly   277 CHPDNSALINPKD 289
            |.|       |||
plant   102 CEP-------PKD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..294 CDD:442714 21/78 (27%)
AT4G22870NP_001154266.1 pepsin_retropepsin_like <4..>31 CDD:472175
PLN03178 <48..153 CDD:215614 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.