DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA3OX3

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_193900.1 Gene:GA3OX3 / 828256 AraportID:AT4G21690 Length:349 Species:Arabidopsis thaliana


Alignment Length:330 Identity:84/330 - (25%)
Similarity:120/330 - (36%) Gaps:80/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLT 66
            |.|.||  ....:|:|.|.|..|...  ||:|..|.|...:.:||:|:..:............|.
plant    37 KPEPET--TSGPIPVISLSNPEEHGL--LRQACEEWGVFHITDHGVSHSLLHNVDCQMKRLFSLP 97

  Fly    67 DEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFS------- 124
            ...|:...||  || |:.||   |:.|             |....||.:..:   |||       
plant    98 MHRKILAVRS--PD-ESTGY---GVVR-------------ISMFYDKLMWSE---GFSVMGSSLR 140

  Fly   125 RHINSLVDD---------------FNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTT- 173
            ||...|..|               .::|...::..|..||.     .|.:....|..|:....| 
plant   141 RHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLG-----LTHEDLGWLVPDKTGSGTD 200

  Fly   174 -----LRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKL---RGSDKWERVGHL 230
                 |::..||...|.......   ..|.|....|:|.|.:..|||::.   .|| :|..|..:
plant   201 SIQSFLQLNSYPVCPDPHLAMGL---APHTDSSLLTILYQGNIPGLEIESPQEEGS-RWIGVEPI 261

  Fly   231 PGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTK 295
            .|:|.:..|:...|.::..:.:..||.|    |:..|. |.|.|||..|       ||:|.|  .
plant   262 EGSLVVIMGDLSHIISNGQFRSTMHRAV----VNKTHH-RVSAAYFAGP-------PKNLQI--G 312

  Fly   296 QTTSD 300
            ..|||
plant   313 PLTSD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 73/304 (24%)
DIOX_N 14..107 CDD:290926 24/92 (26%)
2OG-FeII_Oxy 179..279 CDD:281202 29/102 (28%)
GA3OX3NP_193900.1 PLN02254 1..349 CDD:215142 84/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.