DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G16330

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001190740.1 Gene:AT4G16330 / 827327 AraportID:AT4G16330 Length:364 Species:Arabidopsis thaliana


Alignment Length:331 Identity:74/331 - (22%)
Similarity:133/331 - (40%) Gaps:72/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDLENTIEDVATNLREALSEK----GYALLINHGIS---NEKIKKAWKYFDGFVDLTDEVK 70
            ::|.:||.:     :.:.|||:.:.    |...:||||:.   .::::.....|  |.|...|.|
plant    66 SIPTVDLSS-----SDSAREAIGDACRDWGAFHVINHGVPIHLLDRMRSLGLSF--FQDSPMEEK 123

  Fly    71 LAFE-RSKAPDGENHG----------YVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPG-- 122
            |.:. .|.:...|.:|          .|....:.||..|               |.|.::.|.  
plant   124 LRYACDSTSAASEGYGSRMLLGAKDDVVLDWRDYFDHHT---------------FPPSRRNPSHW 173

  Fly   123 ------FSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPP 181
                  :.:.:....|:..:|.:.:|..::.||..|.|...:    .:.:...|:|   :.:|||
plant   174 PIHPSDYRQVVGEYGDEMKKLAQMLLGLISESLGLPCSSIEE----AVGEIYQNIT---VTYYPP 231

  Fly   182 VEDQDHGRSFIRCG--AHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAI 244
            ....:     :..|  :|:|:...|||.||...||:  |....:|..|..:..|:.|...:...|
plant   232 CPQPE-----LTLGLQSHSDFGAITLLIQDDVEGLQ--LYKDAQWLTVPPISDAILILIADQTEI 289

  Fly   245 WTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSDVIQNAYDIT 309
            .|:..|.:.|||.|..     .:|.|.|:|.|..|..:|.|.|  ::..:..:..:|:...| ::
plant   290 ITNGRYKSAQHRAVTN-----ANRARLSVATFHDPSKTARIAP--VSQLSPPSYKEVVYGQY-VS 346

  Fly   310 MALAKG 315
            ...:||
plant   347 SWYSKG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 69/301 (23%)
DIOX_N 14..107 CDD:290926 24/110 (22%)
2OG-FeII_Oxy 179..279 CDD:281202 30/101 (30%)
AT4G16330NP_001190740.1 DIOX_N 67..174 CDD:290926 27/128 (21%)
PLN03001 107..364 CDD:166642 63/285 (22%)
2OG-FeII_Oxy 227..319 CDD:281202 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.