DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G10500

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_192788.1 Gene:AT4G10500 / 826642 AraportID:AT4G10500 Length:349 Species:Arabidopsis thaliana


Alignment Length:318 Identity:74/318 - (23%)
Similarity:122/318 - (38%) Gaps:81/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SETETLLLQNAVPIIDLEN----TIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFV 63
            ||.|:  ..:::|:|||.:    ....:...|..|.|..|:..:.|||:.:..:.|.        
plant    35 SEVES--SGDSIPLIDLRDLHGPNRAVIVQQLASACSTYGFFQIKNHGVPDTTVNKM-------- 89

  Fly    64 DLTDEVKLAFERSKAPDGE--NHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRH 126
                 ..:|.|....|:.|  .|....|      .:|..|..::|:.  .||.|..:.   |.|.
plant    90 -----QTVAREFFHQPESERVKHYSADP------TKTTRLSTSFNVG--ADKVLNWRD---FLRL 138

  Fly   127 INSLVDDFNE----------------------LGRFILKALAISLDAPPSFFTD---KHSFMLSD 166
            ....::||.|                      |...:|:|::.||.......::   ||:..:: 
plant   139 HCFPIEDFIEEWPSSPISFREVTAEYATSVRALVLRLLEAISESLGLESDHISNILGKHAQHMA- 202

  Fly   167 DRFNLTTLRMLFYPPVEDQD--HGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGH 229
              ||       :|||..:.:  :|     ...|.|....|:|.||...||:|  ...|||..|..
plant   203 --FN-------YYPPCPEPELTYG-----LPGHKDPTVITVLLQDQVSGLQV--FKDDKWVAVSP 251

  Fly   230 LPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            :|....:|.|:.|.:.::..|.::.||.|:..:.:     |.||..|..|...|:|.|
plant   252 IPNTFIVNIGDQMQVISNDKYKSVLHRAVVNTENE-----RLSIPTFYFPSTDAVIGP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 70/306 (23%)
DIOX_N 14..107 CDD:290926 20/98 (20%)
2OG-FeII_Oxy 179..279 CDD:281202 29/101 (29%)
AT4G10500NP_192788.1 PLN02912 4..349 CDD:178500 74/318 (23%)
DIOX_N 44..152 CDD:290926 29/131 (22%)
2OG-FeII_Oxy 199..296 CDD:281202 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.010

Return to query results.
Submit another query.