DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT4G10490

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_192787.1 Gene:AT4G10490 / 826641 AraportID:AT4G10490 Length:348 Species:Arabidopsis thaliana


Alignment Length:332 Identity:77/332 - (23%)
Similarity:128/332 - (38%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SETETLLLQNAVPIIDLEN----TIEDVATNLREALSEKGYALLINHGISNEKIKKAW------- 56
            ||.:|  ..:::|:|||.:    ...|:......|.|..|:..:.|||:..|.|||..       
plant    33 SEVQT--SGDSIPLIDLHDLHGPNRADIINQFAHACSSCGFFQIKNHGVPEETIKKMMNAAREFF 95

  Fly    57 --------KYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELR-HAYNICKLQD 112
                    |::......|..:..:|..||              |:.......|| |.|.|    :
plant    96 RQSESERVKHYSADTKKTTRLSTSFNVSK--------------EKVSNWRDFLRLHCYPI----E 142

  Fly   113 KFLPE-QQLPGFSRHINS-LVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTT-- 173
            .|:.| ...|...|.:.: .......|...:|:|::.||.             |:.||.:.|.  
plant   143 DFINEWPSTPISFREVTAEYATSVRALVLTLLEAISESLG-------------LAKDRVSNTIGK 194

  Fly   174 ----LRMLFYP--PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPG 232
                :.:.:||  |..:..:|     ...|.|....|:|.||...||:|...|  ||..|..:|.
plant   195 HGQHMAINYYPRCPQPELTYG-----LPGHKDANLITVLLQDEVSGLQVFKDG--KWIAVNPVPN 252

  Fly   233 ALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQT 297
            ...:|.|:.|.:.:::.|.::.||.|:...::     |.||..|..|...|:|:|....|..::.
plant   253 TFIVNLGDQMQVISNEKYKSVLHRAVVNSDME-----RISIPTFYCPSEDAVISPAQELINEEED 312

  Fly   298 TSDVIQN 304
            :..:.:|
plant   313 SPAIYRN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/303 (23%)
DIOX_N 14..107 CDD:290926 25/112 (22%)
2OG-FeII_Oxy 179..279 CDD:281202 29/101 (29%)
AT4G10490NP_192787.1 PLN02912 1..348 CDD:178500 77/332 (23%)
DIOX_N 42..150 CDD:290926 28/125 (22%)
2OG-FeII_Oxy 197..294 CDD:281202 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.010

Return to query results.
Submit another query.