DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G50210

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001030834.1 Gene:AT3G50210 / 824183 AraportID:AT3G50210 Length:332 Species:Arabidopsis thaliana


Alignment Length:320 Identity:82/320 - (25%)
Similarity:139/320 - (43%) Gaps:70/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDLENTI---------EDVAT-----NLREALSEKGYALLINHGISNEKIKKAWKYFDGFV 63
            ::|:||:...:         |||..     .|.:|..:.|:..:|.||||.:.|.|..:....|.
plant     7 SLPVIDISRLLLKCDDPDMAEDVGVAEVVQQLDKACRDAGFFYVIGHGISEDVINKVREITREFF 71

  Fly    64 DLTDEVKLAFERSKAPD-------GENHGYVSPGMERFDGRTPELRHA---YNICKLQDKF---- 114
            .|..|.||..:.:.|..       |||   |:.|:       |::..|   |...| |.|:    
plant    72 KLPYEEKLKIKMTPAAGYRGYQRIGEN---VTKGI-------PDIHEAIDCYREIK-QGKYGDIG 125

  Fly   115 -LPE--QQLPGFSRHINSLVDDF----NELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLT 172
             :.|  .|.|...:....|::::    .:|.|.||:.::::|...|..|..|    ::.|.|  .
plant   126 KVMEGPNQWPENPQEFKELMEEYIKLCTDLSRKILRGISLALAGSPYEFEGK----MAGDPF--W 184

  Fly   173 TLRMLFYPPVE------DQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHL 230
            .:|::.||..|      :.|.|     ||||.||...||:.||.: ..|:|:..|.: |.....:
plant   185 VMRLIGYPGAEFTNGQPENDIG-----CGAHTDYGLLTLVNQDDDKTALQVRNLGGE-WISAIPI 243

  Fly   231 PGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDL 290
            ||:...|.|:.:.|.::..|.:..|||     ::...:.|..:|:|...:..|::.|.|:
plant   244 PGSFVCNIGDMLKILSNGVYESTLHRV-----INNSPQYRVCVAFFYETNFDAVVEPLDI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 80/315 (25%)
DIOX_N 14..107 CDD:290926 30/116 (26%)
2OG-FeII_Oxy 179..279 CDD:281202 31/106 (29%)
AT3G50210NP_001030834.1 PLN02485 1..332 CDD:215267 82/320 (26%)
DIOX_N 8..136 CDD:290926 35/138 (25%)
2OG-FeII_Oxy 200..285 CDD:281202 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53543
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100398
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.