DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G47190

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_190303.2 Gene:AT3G47190 / 823872 AraportID:AT3G47190 Length:331 Species:Arabidopsis thaliana


Alignment Length:318 Identity:75/318 - (23%)
Similarity:127/318 - (39%) Gaps:72/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSETETLLLQNA---VPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFV 63
            :..|||.|.::.   :|:||:|:...:   .||||..:.|...|.|.||       ...:.....
plant    17 EKSTETGLDRSKDIDIPVIDMEHLDME---KLREACKDWGIFHLENTGI-------PLTFMSQVK 71

  Fly    64 DLTDEV-KLAFERSKAPDGENH--GY------VSPGMERFDGRTPE-----LRHAYNI------- 107
            ::|:.| .|.||..:...|.|.  .|      |||..:... |.|:     |....||       
plant    72 EITESVLSLPFEEKRTLFGVNSPLSYYWGTHTVSPSGKAVT-RAPQESSGHLFEGINIPLASLSR 135

  Fly   108 -----C---KLQD-KFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFM 163
                 |   ||:. :.:.|:    :.:|:..::....|.   |::.|::.|..      |:....
plant   136 LLALSCTDPKLESFRVVMEE----YGKHVTRIIVTLFEA---IIETLSLELSG------DQKMGY 187

  Fly   164 LSDDRFNLTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVG 228
            ||:   :...:|:..||...:..      ...||.|....:::.||..||||....|  :|..|.
plant   188 LSE---STGVIRVQRYPQCTESP------GLEAHTDSSVISIINQDDVGGLEFMKDG--EWFNVK 241

  Fly   229 HLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALIN 286
            .|..:..:..|:.|.:.:|:.|.::.|:|    ...:|.:.|:||..|..||...:.|
plant   242 PLASSFVVGLGDMMQVISDEEYKSVLHKV----GKRMRKKERYSIVNFVFPDKDCMFN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/307 (23%)
DIOX_N 14..107 CDD:290926 27/106 (25%)
2OG-FeII_Oxy 179..279 CDD:281202 26/99 (26%)
AT3G47190NP_190303.2 PLN02984 1..331 CDD:215534 75/318 (24%)
DIOX_N 32..>86 CDD:290926 18/63 (29%)
2OG-FeII_Oxy 194..288 CDD:281202 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.