DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G46500

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001326613.1 Gene:AT3G46500 / 823803 AraportID:AT3G46500 Length:325 Species:Arabidopsis thaliana


Alignment Length:314 Identity:79/314 - (25%)
Similarity:135/314 - (42%) Gaps:58/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSETE---TLLLQNAVPIIDLENT-IEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDG 61
            |:::|:   :.:..:::..|||.|: :...|.:|::|..:.|:..:.|||||.|...:|::....
plant     1 MENKTQEEASTINVSSLACIDLANSNLHRSAASLKQACLDCGFFYVTNHGISEELKDEAFEQSKK 65

  Fly    62 FVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGR-------------------TPELRHAYNI 107
            |..|..:     |:.|....|.|...||.:.:....                   ||..|  .||
plant    66 FFALPLD-----EKMKVLKNEKHQGYSPVLSQISDNQIHGDYKESFFIGIEGSNDTPFCR--ANI 123

  Fly   108 CKLQDKFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLT 172
            ....|      .|.|:...:.....:...:.:.|.:.||::|:....:|....  ||.:.   ||
plant   124 WPNPD------VLSGWQATMEKYHQEALRVCKAIARVLALALNVDGDYFDTPE--MLGNP---LT 177

  Fly   173 TLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGL------EVKLRGSDKWERVGHLP 231
            .:|:|.|..:.|...|  ...||.|:|:...|||..||..||      :||.|   |||.:..:.
plant   178 FMRLLHYEGMSDPSKG--IYGCGPHSDFGMMTLLGTDSVMGLQICKDRDVKPR---KWEYILSIK 237

  Fly   232 GALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALI 285
            ||..:|.|:.:..|::..:.:..|||:...|      .|:|||:|..|.:..::
plant   238 GAYIVNIGDLLERWSNGIFKSTLHRVLGNGQ------DRYSIAFFLQPSHDCIV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 77/299 (26%)
DIOX_N 14..107 CDD:290926 26/112 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 34/105 (32%)
AT3G46500NP_001326613.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53543
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100398
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.