DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G46490

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_190233.2 Gene:AT3G46490 / 823802 AraportID:AT3G46490 Length:330 Species:Arabidopsis thaliana


Alignment Length:320 Identity:80/320 - (25%)
Similarity:139/320 - (43%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSETE---TLLLQNAVPIIDLENT-IEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDG 61
            |:::||   :::..:::..|||:|: :...|..|::|..:.|:..:||||||.|...:|:::...
plant     1 MENKTEEEVSIIKVSSLTCIDLDNSDLHQSAVLLKQACLDSGFFYVINHGISEELKDEAFEHSKK 65

  Fly    62 FVDLTDEVKLAFERSKA-------------PDGENHGYVSPGME-RFDG-----RTPELRHAYNI 107
            |..|..|.|:...|::.             |:.:..|....|.. .|:|     ...:..|:.||
plant    66 FFALPLEEKMKVLRNEKYRGYAPFHDSLLDPENQVRGDYKEGFTIGFEGSKDGPHWDKPFHSPNI 130

  Fly   108 CKLQDKFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLT 172
            ....|      .|||:...:.....:...:.:.|.|.:|::||             |..|.||  
plant   131 WPNPD------VLPGWRETMEKYYQEALRVCKSIAKIMALALD-------------LDVDYFN-- 174

  Fly   173 TLRMLFYPPVE--------DQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSD----KWE 225
            |..||..|..:        ..|..:....||||:|:...:|||.|...||:: .:..|    |||
plant   175 TPEMLGNPIADMVLFHYEGKSDPSKGIYACGAHSDFGMMSLLATDGVMGLQI-CKDKDVKPQKWE 238

  Fly   226 RVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALI 285
            ....:.||..:|.|:.:..|::.::.:..|||:...|      .|:||.:|..|.:..:|
plant   239 YTPSIKGAYIVNLGDLLERWSNGYFKSTLHRVLGNGQ------DRYSIPFFLKPSHDCII 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 77/305 (25%)
DIOX_N 14..107 CDD:290926 27/112 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 30/111 (27%)
AT3G46490NP_190233.2 PLN03002 1..327 CDD:178579 80/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53543
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100398
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.