DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G46480

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_190232.3 Gene:AT3G46480 / 823798 AraportID:AT3G46480 Length:286 Species:Arabidopsis thaliana


Alignment Length:299 Identity:78/299 - (26%)
Similarity:136/299 - (45%) Gaps:68/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSETE---TLLLQNAVPIIDLEN-TIEDVATNLREALSEKGYALLINHG---ISNEKIKKAWKY 58
            |:::|:   :.:..:::..|||.| ..:..|.:|::  |:|.:||.:...   :.|||.:     
plant     1 MENKTQEEASTIKVSSLTCIDLANPNFQQSAVSLKQ--SKKFFALPLEEKMKVLRNEKHR----- 58

  Fly    59 FDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLP-EQQLPG 122
              |:..:.|::.         |.||         :.||   :.:.::        |:. |..|||
plant    59 --GYSPVLDQIL---------DPEN---------QVDG---DYKESF--------FIGIEVVLPG 92

  Fly   123 FSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDH 187
            :...:.....:...:.:.|.:.||::||...::| ||.. ||.:.   :..:|:|.|..:.|...
plant    93 WRATMEKYHQEALRVCKAIARLLALALDLDTNYF-DKPE-MLGNP---IAVMRLLRYEGMSDPLK 152

  Fly   188 GRSFIRCGAHADYCTFTLLAQDSEGGL------EVKLRGSDKWERVGHLPGALFINCGETMAIWT 246
            |  ...||||:||...||||.||..||      :||.|   |||.|..:.||..:|.|:.:..|:
plant   153 G--IFGCGAHSDYGMLTLLATDSVTGLQICKDKDVKPR---KWEYVPSIKGAYIVNLGDLLERWS 212

  Fly   247 DQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALI 285
            :..:.:..|||:...|      .|:||.:|..|.:..|:
plant   213 NGIFKSTLHRVLGNGQ------DRYSIPFFIEPSHDCLV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 76/284 (27%)
DIOX_N 14..107 CDD:290926 20/96 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 37/105 (35%)
AT3G46480NP_190232.3 PLN03002 1..285 CDD:178579 78/299 (26%)
DIOX_N <34..88 CDD:290926 16/91 (18%)
2OG-FeII_Oxy 144..239 CDD:281202 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53543
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100398
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.