DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and LBO1

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_566685.1 Gene:LBO1 / 821696 AraportID:AT3G21420 Length:364 Species:Arabidopsis thaliana


Alignment Length:352 Identity:80/352 - (22%)
Similarity:139/352 - (39%) Gaps:82/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SETETLLLQNAVPIIDLENTIED-------VATNLREALSEKGYALLINHGISNEKIKKAWKYFD 60
            |..:|..|.:.:|:|||....:.       ....|.:|..:.|:..:|||||..|.::...:...
plant    44 SSLKTHHLHHQIPVIDLSKLSKPDNDDFFFEILKLSQACEDWGFFQVINHGIEVEVVEDIEEVAS 108

  Fly    61 GFVDLTDEVKLAFERSKAP------DGENHGYVSPGMERFDG--------RTPELRHAYNICKLQ 111
            .|.|:..|     |:.|.|      .|....::....::.|.        ..|::|:        
plant   109 EFFDMPLE-----EKKKYPMEPGTVQGYGQAFIFSEDQKLDWCNMFALGVHPPQIRN-------- 160

  Fly   112 DKFLP------EQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFN 170
            .|..|      .:.|.|:|:.|       .||.:.:||.:||||.             |.::||.
plant   161 PKLWPSKPARFSESLEGYSKEI-------RELCKRLLKYIAISLG-------------LKEERFE 205

  Fly   171 ------LTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGH 229
                  :..:||.:|||....|   ..:....|:|....|:|.|.....:.:::...:.|..|..
plant   206 EMFGEAVQAVRMNYYPPCSSPD---LVLGLSPHSDGSALTVLQQSKNSCVGLQILKDNTWVPVKP 267

  Fly   230 LPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITT 294
            ||.||.||.|:|:.:.::..|.:::||.|..     |.:.|.:|..|..|:....|.|  ::...
plant   268 LPNALVINIGDTIEVLSNGKYKSVEHRAVTN-----REKERLTIVTFYAPNYEVEIEP--MSELV 325

  Fly   295 KQTTSDVIQNAYDITMALAKGAFAHHY 321
            ...|:.....:|:      .|.:::||
plant   326 DDETNPCKYRSYN------HGDYSYHY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/306 (23%)
DIOX_N 14..107 CDD:290926 23/113 (20%)
2OG-FeII_Oxy 179..279 CDD:281202 27/99 (27%)
LBO1NP_566685.1 PLN02758 1..362 CDD:215404 80/352 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.