DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G19000

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_566623.1 Gene:AT3G19000 / 821433 AraportID:AT3G19000 Length:352 Species:Arabidopsis thaliana


Alignment Length:312 Identity:88/312 - (28%)
Similarity:131/312 - (41%) Gaps:64/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLQNAVPIID---LENTIED---VATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTD 67
            :..:.:|.||   ||:|..|   :|..:.||....|:..:||||:.:....:..|....|.:||.
plant    27 IFSDEIPTIDLSSLEDTHHDKTAIAKEIAEACKRWGFFQVINHGLPSALRHRVEKTAAEFFNLTT 91

  Fly    68 EVKLAFERSKA-----PDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFL------PE---- 117
            |.|...:|.:.     .|.|:...|....|.||            ..|||..:      ||    
plant    92 EEKRKVKRDEVNPMGYHDEEHTKNVRDWKEIFD------------FFLQDSTIVPASPEPEDTEL 144

  Fly   118 ----QQLPGFSRHINSLVDDF----NELGRFILKALAISLDAP----PSFFTDKHSFMLSDDRFN 170
                .|.|....|...:..::    .:|...:|:.::|||..|    ..||.::.||:    |||
plant   145 RKLTNQWPQNPSHFREVCQEYAREVEKLAFRLLELVSISLGLPGDRLTGFFNEQTSFL----RFN 205

  Fly   171 LTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALF 235
                   .|||..:.:..   :..|.|.|....|:|||||.|||:|..|...:|..|..:..||.
plant   206 -------HYPPCPNPELA---LGVGRHKDGGALTVLAQDSVGGLQVSRRSDGQWIPVKPISDALI 260

  Fly   236 INCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            ||.|..:.:||:..|.:.:||||:...     :.|.||.:|..|.:.|.|.|
plant   261 INMGNCIQVWTNDEYWSAEHRVVVNTS-----KERFSIPFFFFPSHEANIEP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 87/306 (28%)
DIOX_N 14..107 CDD:290926 28/103 (27%)
2OG-FeII_Oxy 179..279 CDD:281202 35/99 (35%)
AT3G19000NP_566623.1 PLN02750 1..352 CDD:178351 88/312 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100398
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.