DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT2G38240

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_181359.1 Gene:AT2G38240 / 818403 AraportID:AT2G38240 Length:353 Species:Arabidopsis thaliana


Alignment Length:303 Identity:75/303 - (24%)
Similarity:133/303 - (43%) Gaps:51/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDLENTIEDVATNL---REALSEKGYALLINHGISN---EKIKKAWKYFDGFVDLTDEVKLA 72
            :|::|: |.:......|   |.|..|.|:..::|||:::   |:::.||:   .|.:|..|.|..
plant    48 IPVLDM-NDVWGKPEGLRLVRSACEEWGFFQMVNHGVTHSLMERVRGAWR---EFFELPLEEKRK 108

  Fly    73 FERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKL--QDKF----LPE-----QQLPGFSRH 126
            :..|  ||         ..|.:..|...::.|    ||  .|.|    ||.     .:.|.....
plant   109 YANS--PD---------TYEGYGSRLGVVKDA----KLDWSDYFFLNYLPSSIRNPSKWPSQPPK 158

  Fly   127 INSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYP--PVEDQDHGR 189
            |..|::.:.|..|.:.:.|..:|........:|....|........:||..|||  |......|.
plant   159 IRELIEKYGEEVRKLCERLTETLSESLGLKPNKLMQALGGGDKVGASLRTNFYPKCPQPQLTLGL 223

  Fly   190 SFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHAL 253
            |     :|:|....|:|..|.: .||:|: || |.|..:..:|.||.:|.|:.:.|.::..|.::
plant   224 S-----SHSDPGGITILLPDEKVAGLQVR-RG-DGWVTIKSVPNALIVNIGDQLQILSNGIYKSV 281

  Fly   254 QHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQ 296
            :|:|::...::     |.|:|:|.:|.:...:.|.:..:|..:
plant   282 EHQVIVNSGME-----RVSLAFFYNPRSDIPVGPIEELVTANR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 73/292 (25%)
DIOX_N 14..107 CDD:290926 24/98 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 30/102 (29%)
AT2G38240NP_181359.1 PLN02393 1..353 CDD:215220 75/303 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.