DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and ATGA2OX3

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_181002.1 Gene:ATGA2OX3 / 818019 AraportID:AT2G34555 Length:335 Species:Arabidopsis thaliana


Alignment Length:310 Identity:72/310 - (23%)
Similarity:125/310 - (40%) Gaps:51/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFERSKA 78
            :|:|||  |..|..|.:.:|..|.|:..:||||:..:.:.:..:....|..|...:|   :::..
plant    27 IPVIDL--TDSDAKTQIVKACEEFGFFKVINHGVRPDLLTQLEQEAINFFALHHSLK---DKAGP 86

  Fly    79 PDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRH--------INSLVDDFN 135
            ||...:|....|.....|....:....|:|      |...:.....||        :...:.:..
plant    87 PDPFGYGTKRIGPNGDLGWLEYILLNANLC------LESHKTTAIFRHTPAIFREAVEEYIKEMK 145

  Fly   136 ELGRFILKALAISLDAPPSFFTDKHSFML----SDDRFNLTTLRMLFYP-----PVEDQDHGRSF 191
            .:....|:.:...|...|.   :|.|.::    ||     :.|||..||     ||:::      
plant   146 RMSSKFLEMVEEELKIEPK---EKLSRLVKVKESD-----SCLRMNHYPEKEETPVKEE------ 196

  Fly   192 IRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHR 256
            |..|.|.|....:||..:...||::.:: ...|..|.....:.|:..|:|:.:.|:..:.:::||
plant   197 IGFGEHTDPQLISLLRSNDTEGLQICVK-DGTWVDVTPDHSSFFVLVGDTLQVMTNGRFKSVKHR 260

  Fly   257 VVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSDVIQNAY 306
            ||...:     |.|.|:.||..|..|..|.|... :..||  .|.:.|.:
plant   261 VVTNTK-----RSRISMIYFAGPPLSEKIAPLSC-LVPKQ--DDCLYNEF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 67/289 (23%)
DIOX_N 14..107 CDD:290926 22/92 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 27/104 (26%)
ATGA2OX3NP_181002.1 PLN02156 1..335 CDD:177816 72/310 (23%)
DIOX_N 27..>94 CDD:290926 19/71 (27%)
2OG-FeII_Oxy 176..278 CDD:281202 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.