DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and ACO1

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_179549.1 Gene:ACO1 / 816478 AraportID:AT2G19590 Length:310 Species:Arabidopsis thaliana


Alignment Length:303 Identity:68/303 - (22%)
Similarity:117/303 - (38%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIID---LENTIEDVATNLREALSEK-GYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFE 74
            :|:||   |:........:|.:...:| |:.::.||||..|.::|..|..:...:  :.:|..|.
plant    11 IPVIDFAELDGEKRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSHYE--EHLKEKFY 73

  Fly    75 RSKAPDGENHGYVSPG---MERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRHINSLVDDF-- 134
            :|:.....:.|..|..   ...|....|    ..|||          |:|..|..::..:|::  
plant    74 QSEMVKALSEGKTSDADWESSFFISHKP----TSNIC----------QIPNISEELSKTMDEYVC 124

  Fly   135 ------NELGRFILKALAI-------SLDAP--PSFFTDKHSFMLSDDRFNLTTLRMLFYPPVED 184
                  ..|.:.:.:.|.:       :...|  |:|.|                 ::..||....
plant   125 QLHKFAERLSKLMCENLGLDQEDIMNAFSGPKGPAFGT-----------------KVAKYPECPR 172

  Fly   185 QDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLP----GALFINCGETMAI 244
            .:..|..   ..|.|.....||.||.: .|||....|  ||..:   |    ..:|:|.|:.:.|
plant   173 PELMRGL---REHTDAGGIILLLQDDQVPGLEFFKDG--KWVPI---PPSKNNTIFVNTGDQLEI 229

  Fly   245 WTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            .::..|.::.|||     :.::|..|.|||.|.:|...|:|:|
plant   230 LSNGRYKSVVHRV-----MTVKHGSRLSIATFYNPAGDAIISP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 67/301 (22%)
DIOX_N 14..107 CDD:290926 21/99 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 30/104 (29%)
ACO1NP_179549.1 PLN02403 9..310 CDD:178025 68/303 (22%)
DIOX_N 11..103 CDD:290926 21/97 (22%)
2OG-FeII_Oxy 166..259 CDD:281202 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.