DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and CG5346

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651058.1 Gene:CG5346 / 42653 FlyBaseID:FBgn0038981 Length:403 Species:Drosophila melanogaster


Alignment Length:394 Identity:174/394 - (44%)
Similarity:229/394 - (58%) Gaps:84/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETLLLQNAVPIIDL----------ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFD 60
            :|||.::.||||||          ::.:..|...|::||||||.|||:|||||:||:|.||.:.|
  Fly    12 DTLLSRSVVPIIDLAHCGIEEVPVKSVVNRVGHQLKKALSEKGMALLVNHGISDEKLKTAWDHLD 76

  Fly    61 GFVDLTDEVKLAFERSKAPDGENHGYVSPG-MERFDGRTPELRHAYNICKLQDKFLPEQQLPGFS 124
            .||:|..:::..:.|:   ||:.|||||.| .:||||::||||||:||..|..:.|||:.||||:
  Fly    77 DFVNLPPDIRQHYIRA---DGDKHGYVSRGQQQRFDGKSPELRHAFNISTLNAQNLPEEPLPGFA 138

  Fly   125 RHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGR 189
            .||::|..||..|..|||:|||:|||.|.:||.:|||.|||.|..|:::||||:|||:.|.:.|:
  Fly   139 DHISTLATDFKALASFILQALAVSLDIPHTFFLEKHSHMLSGDHDNMSSLRMLYYPPIVDDEPGQ 203

  Fly   190 ----------------------------------------------------SFIRCGAHADYCT 202
                                                                :.|:|..|.||.|
  Fly   204 NDVIKGRCQYSYQRCLSNQPDFRPEHNPRDEDDLNEVDGPNGQLFEHKLGNGAVIQCPPHVDYGT 268

  Fly   203 FTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRH 267
            ||||:|||||||||:|.||:||.|||||||::.:||||.:.|||...|.||||||:||:|..||.
  Fly   269 FTLLSQDSEGGLEVRLPGSEKWNRVGHLPGSILVNCGEILNIWTQGRYPALQHRVIIPEQETIRA 333

  Fly   268 RGRHSIAYFCHPDNSALINPKDL--------NITTKQ------TTSDVIQNAYDITMALAKGAFA 318
            |||||||:||||||...|:|.||        ....||      ...:.:.|||.    |.:..|.
  Fly   334 RGRHSIAFFCHPDNITTISPTDLPNPDAVQDKACLKQRKKSFKAAKERVYNAYQ----LIQKKFR 394

  Fly   319 HHYS 322
            ..||
  Fly   395 DTYS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 159/336 (47%)
DIOX_N 14..107 CDD:290926 50/103 (49%)
2OG-FeII_Oxy 179..279 CDD:281202 64/151 (42%)
CG5346NP_651058.1 PcbC 16..367 CDD:226022 162/353 (46%)
DIOX_N 20..131 CDD:290926 54/113 (48%)
2OG-FeII_Oxy <260..345 CDD:281202 58/84 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469694
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440238at33208
OrthoFinder 1 1.000 - - FOG0012092
OrthoInspector 1 1.000 - - otm25841
orthoMCL 1 0.900 - - OOG6_100398
Panther 1 1.100 - - P PTHR10209
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
109.890

Return to query results.
Submit another query.