DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G06645

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001154315.2 Gene:AT1G06645 / 3766668 AraportID:AT1G06645 Length:379 Species:Arabidopsis thaliana


Alignment Length:313 Identity:75/313 - (23%)
Similarity:119/313 - (38%) Gaps:103/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLQNAVPIIDL-----------ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDG 61
            ||....:|.|||           :|.||    .::||..:.|:..:||||:|.|.::|       
plant    71 LLHLKTIPTIDLGGRVFEDELKHKNAIE----KIKEAAEKWGFFQVINHGVSLELLEK------- 124

  Fly    62 FVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKF------------ 114
                                     :..|:..|..::||:|..:....|..||            
plant   125 -------------------------MKDGVRGFHEQSPEVRKDFYSRDLTRKFQYSSNFDLYSSP 164

  Fly   115 -----------LPEQQLPGFSRHINSLVDDFNE----LGRFILKALAISLDAPPSFFTD----KH 160
                       :.......:||.::..: :::|    ||.|:...|:.:|...|:...|    |.
plant   165 AANWRDTVACTMDPDPSTRYSRDLDVTI-EYSEQVMNLGEFLFTLLSEALGLNPNHLNDMDCSKG 228

  Fly   161 SFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIRCGA--HADYCTFTLLAQDSEGGLEVKLRGSDK 223
            ..||..           :|||..:.|     :..|.  |||....|:|..|...||:|...|  .
plant   229 LIMLCH-----------YYPPCPEPD-----LTLGTSQHADNTFLTVLLPDQIEGLQVLREG--Y 275

  Fly   224 WERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYF 276
            |..|.|:||||.||.|:.:.:.|:..:.:|:|||:    .:...|.|.|:|.|
plant   276 WFNVPHVPGALIINIGDLLQLITNDKFVSLEHRVL----ANRATRARVSVAGF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 73/308 (24%)
DIOX_N 14..107 CDD:290926 22/103 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 35/100 (35%)
AT1G06645NP_001154315.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.