DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5346 and AT2G06960

DIOPT Version :10

Sequence 1:NP_651058.1 Gene:CG5346 / 42653 FlyBaseID:FBgn0038981 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_178713.1 Gene:AT2G06960 / 815265 AraportID:AT2G06960 Length:148 Species:Arabidopsis thaliana


Alignment Length:73 Identity:24/73 - (32%)
Similarity:37/73 - (50%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EVDGPNGQLFEHKLGNGAVI-----QCP-PHV---DYGTFTLLSQDSEGGLEVRLPGSEKWNRVG 294
            |:||.:....|.:.|:..|:     .|| |.:   :||..|||.||...||::..  .::|..|.
plant    10 EIDGGDEAAEELEKGSQVVVVNCYPPCPEPELTPSNYGFLTLLLQDDVEGLQILY--RDEWVTVD 72

  Fly   295 HLPGSILV 302
            .:|||.:|
plant    73 PIPGSFVV 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5346NP_651058.1 PcbC 20..366 CDD:442714 24/73 (33%)
AT2G06960NP_178713.1 PLN02947 <1..148 CDD:215510 24/73 (33%)

Return to query results.
Submit another query.