DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and TAAR8

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens


Alignment Length:344 Identity:108/344 - (31%)
Similarity:170/344 - (49%) Gaps:43/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QDIQASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLA 150
            :|:..|...|..:.||   .::....|..|.::  |:.||:||:.||:..::|...||:.:.|||
Human    15 EDVNGSCIETPYSPGS---RVILYTAFSFGSLL--AVFGNLLVMTSVLHFKQLHSPTNFLIASLA 74

  Fly   151 VADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDY 215
            .||.||.:..|.|:....:...|.||:..|.:.:..||.|..:|::|||.|.:|||..:..||.|
Human    75 CADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVY 139

  Fly   216 PLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHI---CEFKVNKAYAIVSS 277
            ....|.....|.:.:.|:.|...|.....:|  ...:..:.|.|..:.   |:..|::.:.:: .
Human   140 ATKFTVSVSGICISVSWILPLTYSGAVFYTG--VNDDGLEELVSALNCVGGCQIIVSQGWVLI-D 201

  Fly   278 SMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQST---- 338
            .:.|:||.:||:.:|.:|:..|.:|          |:.:|           ..|.:||.|:    
Human   202 FLLFFIPTLVMIILYSKIFLIAKQQ----------AIKIE-----------TTSSKVESSSESYK 245

  Fly   339 ISTMRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDS---CITPRLLVGILFWIGYFNSALN 400
            |...:||||||:|||:.:.||:|.|||    |.|..|.|:   .:||..:..|..|..|:|||:|
Human   246 IRVAKRERKAAKTLGVTVLAFVISWLP----YTVDILIDAFMGFLTPAYIYEICCWSAYYNSAMN 306

  Fly   401 PIIYAYFNRDFRAAFKKTL 419
            |:|||.|...||.|.|..|
Human   307 PLIYALFYPWFRKAIKLIL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/118 (35%)
7tm_1 124..404 CDD:278431 91/289 (31%)
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 91/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.