DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and or30bt3

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571828.2 Gene:or30bt3 / 80371 ZFINID:ZDB-GENE-070806-52 Length:320 Species:Danio rerio


Alignment Length:381 Identity:72/381 - (18%)
Similarity:131/381 - (34%) Gaps:145/381 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FVKCFII------------------GFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADM 154
            |||.|:|                  .|:.:..::||.:.....:..:.|.....||:::|.|:|:
Zfish     8 FVKDFVIVGFPGLQPHYYGLVSALLFFVYVFTLIGNAVFFTLFVITKSLHKPVYYFIINLVVSDV 72

  Fly   155 LVALCAMTFNASVMISGKWMFGSVM----CDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDY 215
            |.:...:|    .:||..|.....:    |.:...|...|.:...:.|..:::|||.||..||.|
Zfish    73 LFSTATLT----KIISRYWFQDGTISFLGCFVQMFFVHLFGSVCSVVLAVMAIDRYTAICYPLQY 133

  Fly   216 PLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMS 280
            ..|||.|.|.|::|..|:                                             :|
Zfish   134 HSIMTNRNVLILILSPWI---------------------------------------------LS 153

  Fly   281 FWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRE 345
            ||.|    |::..|.|.       |.|.:..:.:    |.....:            :|:|:...
Zfish   154 FWGP----LALVIRAYP-------LPYCADNSII----HCYCDHV------------SITTLACT 191

  Fly   346 RKAARTLGIIMSAFLICWLPFFLWYIVSSLCD------------------SCITPRLLVGILFWI 392
            .::..::..::.||||..:||.:  |:.|.|.                  |..:|:|::..|::|
Zfish   192 DRSLYSIPALIYAFLILLVPFAV--IIFSYCSIFIAVMRISGSQGRMKTFSTCSPQLIIIALYFI 254

  Fly   393 ----GYFNS-----------------------ALNPIIYAYFNRDFRAAFKKTLKS 421
                .:.:|                       .:|||||.....:.:...::..|:
Zfish   255 PRILNFLSSNIGLKFSTDLRLIMIMMYSVLPPLINPIIYCLRTEEVKKVLRQQFKN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 35/140 (25%)
7tm_1 124..404 CDD:278431 63/328 (19%)
or30bt3NP_571828.2 7tm_4 34..311 CDD:304433 67/355 (19%)
7tm_1 42..293 CDD:278431 63/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.