DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar14g

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076524.1 Gene:taar14g / 795424 ZFINID:ZDB-GENE-100510-1 Length:331 Species:Danio rerio


Alignment Length:342 Identity:86/342 - (25%)
Similarity:162/342 - (47%) Gaps:62/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFVKCFIIGFIILAA-----ILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNAS 166
            |.:..::|.::..||     :.||:||::||...::|....|..::|||.:|:||.:..:..:.|
Zfish    22 VSLSVYVILYVAAAAVALLTVCGNLLVMISVSHFKQLHTPANILILSLAASDLLVGVFVIPLHLS 86

  Fly   167 VMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMV 231
            ::|...|:.|.|||.::...:...::.|:..:..|:|||:.|:..|..|...::...|....|:.
Zfish    87 LLIESCWISGPVMCSIFKFVNFQPTSVSVHTVALIAVDRFLALSFPFFYSEKISLNVVCTAALLN 151

  Fly   232 WLSPALLSFLPICSGWYTTTENYKYLKSN------PHICEFKVNKAYAIVSSSMSFWIPGIVMLS 290
            ||...:.:|            ...|:..|      |..|.:.::...:|:...:.|.:|..:::.
Zfish   152 WLFSLIYNF------------TLFYINGNFTDSVCPGECVYNIDGTSSIIDLLIVFVMPCTLIII 204

  Fly   291 MYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRR-----ERKAAR 350
            :|..::                 ::.:||....:      ::||..||.|:..:     |||||.
Zfish   205 LYTHVF-----------------VIAKKHATAIR------ALQVHNSTESSKNKISDKSERKAAM 246

  Fly   351 TLGII----MSAFLICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDF 411
            .|||:    :..||:|.||:::.::|... .|.|.....|.::|:  :.||.:||||||.    |
Zfish   247 LLGILVFKALPVFLLCLLPYYITFLVIPY-GSVINFVRDVAVIFF--FLNSTINPIIYAL----F 304

  Fly   412 RAAFKKTLKSLFPYAFY 428
            .:.|||:||.:|.:..:
Zfish   305 YSWFKKSLKLIFTFKVF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 34/123 (28%)
7tm_1 124..404 CDD:278431 72/294 (24%)
taar14gNP_001076524.1 7tm_1 44..301 CDD:278431 72/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.