DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar12h

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076378.1 Gene:taar12h / 795068 ZFINID:ZDB-GENE-041014-54 Length:344 Species:Danio rerio


Alignment Length:337 Identity:106/337 - (31%)
Similarity:159/337 - (47%) Gaps:38/337 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            ::..:||..:.||:|||:|:...::|:..|:..|.|||..|.|:....|.::....:.|.|..|:
Zfish    40 VMVLMILTTVFGNLLVIISISHFKQLQSPTHLIVQSLAACDCLLGSLVMPYSMVRSVEGCWYLGT 104

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            |:|.:.:|.|:.||.:||:||..|::||::||..||.|.:.:|...|...:...||...:.||..
Zfish   105 VVCKVHSSLDMTFSISSILHLSLIAIDRFWAISDPLRYKMRVTNTTVAGFITFTWLFSFVYSFSV 169

  Fly   243 ICSGWYTTTENYKYLKSNPHI-----CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQ 302
            :    :|...|....:....|     |....||.:.::.:...|.|||.:|.|:|..|:....|.
Zfish   170 V----FTGVNNVGLEELILQISCFGGCVLFFNKEWGLICALFVFLIPGTIMSSLYMSIFNVVKRH 230

  Fly   303 ERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFF 367
            .:::.....||.....|.|.|.                  .||||||:||.|:|..|.:||||||
Zfish   231 AKVMSEKVSAAATAGSHFQTSS------------------HRERKAAKTLAIVMGVFYLCWLPFF 277

  Fly   368 LWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPYAFYFCRR 432
            ....|....:.. ||..:...|.|.|||||..||:||.:|...|:.|||..:.:      |.|  
Zfish   278 TATAVDPFLNFS-TPGDVFDALVWFGYFNSTCNPLIYGFFYPRFQKAFKILIST------YIC-- 333

  Fly   433 GRGRDDDRDLEF 444
              |..|...|.|
Zfish   334 --GSSDSHTLTF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 40/117 (34%)
7tm_1 124..404 CDD:278431 91/284 (32%)
taar12hNP_001076378.1 7tm_4 49..325 CDD:304433 96/298 (32%)
7tm_1 51..313 CDD:278431 91/284 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.