DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar12g

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076377.1 Gene:taar12g / 794997 ZFINID:ZDB-GENE-041014-64 Length:336 Species:Danio rerio


Alignment Length:348 Identity:104/348 - (29%)
Similarity:169/348 - (48%) Gaps:42/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VVAGQAQDIQASEGSTDDADGSSH-LALVFVKCFI-IGFIILAAILGNMLVIVSVMRHRKLRIIT 142
            :.:.::::||.......::....| ||:|.|..:| :..:||..:.||:|:|:|:...:.|:..|
Zfish     1 MTSNESENIQLCYPLLSNSCPKLHRLAVVQVGLYICLLLMILTTVFGNLLIIISISHFKHLQSPT 65

  Fly   143 NYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYY 207
            :..|.|||..|.|:....|..:....:.|.|..|.|:|.:.:|.|:....:|::||..||||||.
Zfish    66 HLIVRSLAACDCLLGSLVMPNSMVRSVEGCWYLGDVVCKVHSSLDMTLCISSLLHLGLISVDRYL 130

  Fly   208 AIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHI---CEFKVN 269
            ||..||.|.:.:|...|.:..:.:||...:.||....||  .|....:.|....:.   |....|
Zfish   131 AICDPLRYRIRVTNTTVTVFTVFIWLFSVVYSFYVKFSG--ITAVGLEMLILQTYCVGRCVVFFN 193

  Fly   270 KAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQV 334
            |.:.::...::|::||.:|.|:|.:|:..|.:|.:::.......|                    
Zfish   194 KQWGLICPVLAFFLPGAIMSSLYMKIFHVARKQAKVISERVTGGL-------------------- 238

  Fly   335 EQSTISTMRRERKAARTLGIIMSAFLICWLPFFL------WYIVSSLCDSCITPRLLVGILFWIG 393
              .:.|:.:||||||:||.|:|..||.||:|||.      ::...|..|       :...|||..
Zfish   239 --KSQSSAQRERKAAKTLAIVMGVFLFCWMPFFTLTALDPFFNFLSSAD-------VFDALFWFA 294

  Fly   394 YFNSALNPIIYAYFNRDFRAAFK 416
            |.|||.||:||.:|...|:.|||
Zfish   295 YLNSACNPLIYGFFYPCFQKAFK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 40/119 (34%)
7tm_1 124..404 CDD:278431 87/288 (30%)
taar12gNP_001076377.1 7tm_4 45..317 CDD:304433 92/302 (30%)
7tm_1 47..305 CDD:278431 87/288 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.