DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar1b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076373.1 Gene:taar1b / 794715 ZFINID:ZDB-GENE-041014-58 Length:332 Species:Danio rerio


Alignment Length:317 Identity:102/317 - (32%)
Similarity:156/317 - (49%) Gaps:46/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSV 178
            |..||....:||:|||:|:...|:|...||..::|||:.|.|:.|..|..:|...:.|.|.||..
Zfish    29 IMLIISMTFIGNLLVIISIGHFRQLHTPTNQLILSLALCDFLIGLFVMPLSAVRSMQGCWYFGEF 93

  Fly   179 MCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPI 243
            :|.:....|:..||:||.||..:|.:|:.|:..||.|........|.:|:.:.||.|.:.:::  
Zfish    94 LCKLHTCIDITLSTSSIFHLVSVSAERFCAVCGPLRYRSCFGLSTVLLMISISWLIPGIFAYV-- 156

  Fly   244 CSGWYTTTENYKYLKSNPH--------------ICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYR 294
                      ..:|:.|.|              .|....:...|:.:|..||:|||.:::.:|.|
Zfish   157 ----------MTFLEINIHGGKDFYDAHVRCVGGCHVFFSHGPAVFTSVFSFYIPGFIIVVIYSR 211

  Fly   295 IYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAF 359
            ||..|..|||.:            .||::|:.:..||..|:..|       |||..|:.|::.||
Zfish   212 IYMVARNQERSI------------RLQLNQLRRVYPSRDVQLQT-------RKATVTIAIVVGAF 257

  Fly   360 LICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK 416
            |:||.||||..|::... ...||.:|:.:|.|.||.||.|||.|||:.:...|.|.:
Zfish   258 LVCWTPFFLCNILNPFI-GYATPPMLIDVLMWFGYANSTLNPFIYAFMHSWCRKAVR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 41/116 (35%)
7tm_1 124..404 CDD:278431 94/293 (32%)
taar1bNP_001076373.1 7tm_4 31..>159 CDD:304433 43/139 (31%)
7tm_1 39..301 CDD:278431 94/293 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.