DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar10b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076372.1 Gene:taar10b / 794579 ZFINID:ZDB-GENE-041014-67 Length:336 Species:Danio rerio


Alignment Length:317 Identity:109/317 - (34%)
Similarity:159/317 - (50%) Gaps:49/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FIILAA-----ILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMF 175
            :|:.:|     |:||:|||::|:..|:|...|||.::||||||:||....|..:....|...|..
Zfish    41 YILFSASSIITIIGNLLVIITVVHFRQLHTPTNYLILSLAVADLLVGGVVMPPSMLRSIETCWYL 105

  Fly   176 GSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSF 240
            |.:.|.:.:|.||...||||::||.||:||||||..|..|...||.....:|:::.|...|:|.|
Zfish   106 GDLFCKIHSSLDVTLCTASILNLCIISLDRYYAICHPFQYHSKMTSLATLVMIIICWTVSAVLGF 170

  Fly   241 LPI--------CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQ 297
            ..|        ...:|     |:.:..|.....|: ::..|:..|...|:||..|||.:|.:|..
Zfish   171 GMIFMELNILGVEDFY-----YENVDCNGRCLVFQ-SREVAVFMSLACFYIPAFVMLCVYLKILH 229

  Fly   298 EADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLIC 362
            ||.||                             :|..||..|.:::|.||.:||.||:..||..
Zfish   230 EAQRQ-----------------------------VQAIQSVNSELKKEGKATKTLAIIVGVFLTF 265

  Fly   363 WLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL 419
            |:||||..::.......:.| ||..:..|:||:||..|||:||:|...||.||:..|
Zfish   266 WIPFFLCNLIDPFIGYSVPP-LLFDLFLWVGYYNSTCNPIVYAFFYSWFRHAFRVIL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 49/119 (41%)
7tm_1 124..404 CDD:278431 98/287 (34%)
taar10bNP_001076372.1 7tm_4 44..307 CDD:304433 100/298 (34%)
7tm_1 54..306 CDD:278431 98/287 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.