DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar10d

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076371.1 Gene:taar10d / 794512 ZFINID:ZDB-GENE-041014-97 Length:336 Species:Danio rerio


Alignment Length:325 Identity:114/325 - (35%)
Similarity:168/325 - (51%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAA-----ILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGK 172
            |:.:|:|:|     |:||:|||::|:..|:|...|||.::||||||:||....|..:....|...
Zfish    38 ILFYILLSASSIITIIGNLLVIITVVHFRQLHTPTNYLILSLAVADLLVGGVVMPPSMLRSIETC 102

  Fly   173 WMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPAL 237
            |..|.:.|.:.:|.||...||||::||.||:||||||..|..|...||.....:|:::.|...|:
Zfish   103 WYLGDLFCKIHSSLDVTLCTASILNLCIISLDRYYAICHPFQYHSKMTSLATLVMIIICWTVSAV 167

  Fly   238 LSFLPI--------CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYR 294
            |.|..|        ...:|     |:.:|.:.. |....:|....|.|.:.|:||.:|:|.:|.:
Zfish   168 LGFGMIFMELNILGVEDFY-----YENIKCDGG-CTLFQSKTGGTVFSLICFYIPALVILFVYLK 226

  Fly   295 IYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAF 359
            |..||.||                             :|..||..|.:::|.||.:||.||:..|
Zfish   227 ILHEAQRQ-----------------------------VQAIQSVNSELKKEGKANKTLAIIIGVF 262

  Fly   360 LICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL-KSLF 423
            |..|:||||..::.......:.| ||..:.:||||:||..|||:||:|...||.||:..| |::|
Zfish   263 LTLWVPFFLCNLIDPFIGYSVPP-LLFDLFYWIGYYNSTCNPIVYAFFYSWFRHAFRVILSKAIF 326

  Fly   424  423
            Zfish   327  326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 51/122 (42%)
7tm_1 124..404 CDD:278431 99/287 (34%)
taar10dNP_001076371.1 7tm_4 48..>165 CDD:304433 48/116 (41%)
7tm_1 54..306 CDD:278431 99/287 (34%)
7tm_4 <130..275 CDD:304433 54/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.