DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and taar10a

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001076367.1 Gene:taar10a / 794359 ZFINID:ZDB-GENE-041014-55 Length:336 Species:Danio rerio


Alignment Length:321 Identity:115/321 - (35%)
Similarity:163/321 - (50%) Gaps:47/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 FIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFG 176
            |.|..||  .|:||:|||::|:..|:|...|||.::||||||:||....|..:....|...|..|
Zfish    44 FSISSII--TIIGNLLVIITVVHFRQLHTPTNYLILSLAVADLLVGGVVMPPSMLRSIETCWYLG 106

  Fly   177 SVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFL 241
            .:.|.:.:|.||...||||::||.||:||||||..|..|...||.....||:::.|...|:|.|.
Zfish   107 DLFCKIHSSLDVTLCTASILNLCIISLDRYYAICHPFQYHSKMTSLATLIMIIICWTVSAVLGFG 171

  Fly   242 PI--------CSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQE 298
            .|        ...:|     |:.::.:.....|: :|....|.|.:.|:||..|||.:|.:|..|
Zfish   172 MIFMELNILGVEDFY-----YENIRCDGGCFVFQ-SKTGGTVFSLICFYIPAFVMLGVYLKILHE 230

  Fly   299 ADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICW 363
            |.||                             :|..||..|.:::|.||.:||.|||..||..|
Zfish   231 AQRQ-----------------------------VQAIQSVNSELKKEGKATKTLAIIMGVFLTFW 266

  Fly   364 LPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTL-KSLF 423
            :||||..::..|....: |.|:..:..|:||:||..|||:||:|...||.||:..| |.:|
Zfish   267 IPFFLCNLIDPLIGYSV-PSLVFDLFLWVGYYNSTCNPIVYAFFYSWFRHAFRVILSKRVF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 52/118 (44%)
7tm_1 124..404 CDD:278431 100/287 (35%)
taar10aNP_001076367.1 7tm_1 54..306 CDD:278431 100/287 (35%)
7tm_4 55..>165 CDD:304433 47/109 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.