DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and drd1b

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001129448.1 Gene:drd1b / 568126 ZFINID:ZDB-GENE-070524-2 Length:446 Species:Danio rerio


Alignment Length:339 Identity:135/339 - (39%)
Similarity:191/339 - (56%) Gaps:26/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRI-ITNYFVVSLAVADML 155
            :.|....|.|..   |...|| :..:||..:|||.||..:|.:.|.||. :||:||:|||::|:|
Zfish    10 DSSVSQRDSSKR---VLTGCF-LSLLILTTLLGNTLVCAAVTKFRHLRSKVTNFFVISLAISDLL 70

  Fly   156 VALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMT 220
            ||:..|.:.|:..|.|.|.||: .||:|.:||:..|||||::||.||||||:||..|..|...||
Zfish    71 VAILVMPWKAATEIVGFWPFGA-FCDVWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMT 134

  Fly   221 QRRVFIMLLMVWLSPALLSFLPICSGWY---TT--TE-NYKYLKSNPHICEFKVNKAYAIVSSSM 279
            .:..|||:.:.|....|:||:|:...|:   ||  || |..|.:..|..|:..:|:.|||.||.:
Zfish   135 PKVAFIMISVAWTLSILISFIPVQLNWHKAQTTSYTELNGTYGELPPDNCDSSLNRTYAISSSLI 199

  Fly   280 SFWIPGIVMLSMYYRIYQEADRQ-ERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMR 343
            ||:||..:||..|.|||:.|.:| .|:....:.|.....:|..:..    ..|::.|.|...:.:
Zfish   200 SFYIPVAIMLVTYTRIYRIAQKQIRRISALERAAESAKNRHSSMGN----NASMESESSFKMSFK 260

  Fly   344 RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDS-------CITPRLLVGILFWIGYFNSALNP 401
            ||.|..:||.:||..|:.||||||:...:...|:.       ||:.... .:..|.|:.||:|||
Zfish   261 RETKVLKTLSVIMGVFVCCWLPFFVLNCMVPFCNPNESTDFLCISSTTF-DVFVWFGWANSSLNP 324

  Fly   402 IIYAYFNRDFRAAF 415
            |||| ||.|||.||
Zfish   325 IIYA-FNADFRKAF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 57/119 (48%)
7tm_1 124..404 CDD:278431 116/294 (39%)
drd1bNP_001129448.1 7tm_1 42..327 CDD:278431 113/290 (39%)
7tm_4 43..>156 CDD:304433 53/113 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.