DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and LOC567498

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_005159907.1 Gene:LOC567498 / 567498 -ID:- Length:398 Species:Danio rerio


Alignment Length:345 Identity:122/345 - (35%)
Similarity:181/345 - (52%) Gaps:55/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR-IITNYFVVSLAVADMLVALCAMTFNASVMIS 170
            ||:.| .:..::|..:|||.:|..:|:|.|.|| .:||.|:||||::|:|||:..|.:.|:..::
Zfish    22 VFLGC-ALSLLVLWTLLGNFMVCAAVLRFRHLRGKVTNVFIVSLAMSDLLVAVLVMPWKAATEVT 85

  Fly   171 GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSP 235
            |.|.||| .|:.|.:||:..|||||::||.||:|||:||..|..|...|.:|...:|:.:.|:..
Zfish    86 GHWAFGS-FCECWVAFDIMCSTASILNLCVISLDRYWAISDPFQYERKMNRRVALVMVSVTWIVS 149

  Fly   236 ALLSFLPICSGWY------TTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYR 294
            ..:||:|:...|:      ..|.|:    :...:|:..::::|||.||.:||:||..|||..|.|
Zfish   150 VAISFVPVQLNWHRADLDTVNTSNW----TTKEMCDSSLSRSYAISSSLISFYIPVAVMLVTYTR 210

  Fly   295 IYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMR---------RERKAAR 350
            ||:.|                   .:||..|.....:.:..||..:..|         ||.|..:
Zfish   211 IYRIA-------------------QIQIKSISSLERAAERAQSCSAGARTCPLQHRAIRETKLFK 256

  Fly   351 TLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRA 413
            ||.:||..|:.||.|||:.......|  ..|:: .....:..|.|:.||:||||||| ||.|||.
Zfish   257 TLSVIMGVFVCCWFPFFVLNCAVPFCHKPDCVS-EATFNVFVWFGWCNSSLNPIIYA-FNSDFRD 319

  Fly   414 AFKKTLKSLFPYAFYFCRRG 433
            ||.:.|          |.||
Zfish   320 AFARLL----------CCRG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 51/119 (43%)
7tm_1 124..404 CDD:278431 103/297 (35%)
LOC567498XP_005159907.1 7tm_1 38..311 CDD:278431 103/297 (35%)
7tm_4 <104..>156 CDD:304433 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.