DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar9

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001010831.1 Gene:Taar9 / 503558 MGIID:3527454 Length:348 Species:Mus musculus


Alignment Length:325 Identity:107/325 - (32%)
Similarity:158/325 - (48%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            ::|...|.|:.||:|||::::..::|...||:.|.|||.||.||.:..|.|:....:...|.||.
Mouse    38 VLGLGALLAVFGNLLVIIAILHFKQLHTPTNFLVASLACADFLVGVTVMPFSTVRSVESCWYFGE 102

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            ..|.....||..|..||:.||||||:|||.|:..||.||...|.....:.:.:.|......||  
Mouse   103 SYCKFHTCFDTSFCFASLFHLCCISIDRYIAVTDPLTYPTKFTVSVSGLCIALSWFFSVTYSF-- 165

  Fly   243 ICSGWYTTT-----ENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQ 302
              |.:||..     |......:....|:..:|:.:.:: ..:.|::|.:||:.:|.||:..|..|
Mouse   166 --SIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVLL-CFLLFFLPTVVMVFLYGRIFLVAKYQ 227

  Fly   303 ERLV-------------YRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGI 354
            .|.:             |:.:||                              :||||||:||||
Mouse   228 ARKIEGTANQAQASSESYKERVA------------------------------KRERKAAKTLGI 262

  Fly   355 IMSAFLICWLPFFLWYIVSSLCD---SCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK 416
            .|:|||:.|||    ||:.::.|   :.|||..:..||.|..|:|||:||:|||:|...||.|.|
Mouse   263 AMAAFLVSWLP----YIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLIYAFFYPWFRKAIK 323

  Fly   417  416
            Mouse   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 45/117 (38%)
7tm_1 124..404 CDD:278431 96/300 (32%)
Taar9NP_001010831.1 7tm_4 43..>168 CDD:304433 48/128 (38%)
7tm_1 49..311 CDD:278431 96/300 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.