DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar3

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001009532.1 Gene:Taar3 / 494319 RGDID:1359566 Length:342 Species:Rattus norvegicus


Alignment Length:325 Identity:101/325 - (31%)
Similarity:162/325 - (49%) Gaps:41/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDM 182
            ::..|.||:::|:|:...::|...||:.::|:|..|.|:....|.::....:...|.||...|..
  Rat    42 MVITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKF 106

  Fly   183 WNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSF-LPICSG 246
            ..|||:..|..||.|||.|::||:||:..||.|...||...:..:|...|.:|||.|| |.:...
  Rat   107 HASFDMMLSLTSIFHLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAAPALFSFGLVLSEA 171

  Fly   247 WYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQER----LVY 307
            ..:..::|:.|.:..:.|....||.:..:..:..|:.||.:|:.:|.:|:..:.|..|    :..
  Rat   172 NVSGMQSYEILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALGNMPE 236

  Fly   308 RSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLWYIV 372
            .:|.|...|.|                        :::||||:||||:|..||.||||.||..::
  Rat   237 NTKGAGRNLSK------------------------KKDRKAAKTLGIVMGVFLACWLPCFLAVLI 277

  Fly   373 SSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK-----KTLKS------LFPYA 426
            ....|.. ||.:::.:|.|:|||||..||:|:.:|...||.|.:     |..:|      |||.|
  Rat   278 DPYLDYS-TPIIVLDLLVWLGYFNSTCNPLIHGFFYPWFRKALEHIVSGKIFRSNSDTANLFPEA 341

  Fly   427  426
              Rat   342  341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 37/112 (33%)
7tm_1 124..404 CDD:278431 89/284 (31%)
Taar3NP_001009532.1 7tm_4 43..>190 CDD:304433 46/146 (32%)
7tm_1 48..307 CDD:278431 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.