DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar3

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001008429.1 Gene:Taar3 / 493809 MGIID:3527427 Length:343 Species:Mus musculus


Alignment Length:328 Identity:104/328 - (31%)
Similarity:169/328 - (51%) Gaps:35/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 FIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFG 176
            |:.|.::: .|.||:::|:|:...::|...||:.::|:|..|.|:....|.::....:...|.||
Mouse    37 FMTGAMVI-TIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFG 100

  Fly   177 SVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSF- 240
            ...|....|||:..|..||.|||.|::||:||:..||.|...||...:..:|...|.:|||.|| 
Mouse   101 DSFCKFHASFDMMLSLTSIFHLCSIAIDRFYAVCDPLHYTTTMTVSMIKRLLAFCWAAPALFSFG 165

  Fly   241 LPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERL 305
            |.:.....:..::|:.|.:..:.|....||.:..:..:..|:.||.:|:.:|.:|:        :
Mouse   166 LVLSEANVSGMQSYEILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIF--------I 222

  Fly   306 VYRSKVAALLLEKHLQISQIP-KPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLPFFLW 369
            |.|....||        |.:| ..:.::....|    .:::||||:||||:|..||.||||.||.
Mouse   223 VSRRHARAL--------SDMPANTKGAVGKNLS----KKKDRKAAKTLGIVMGVFLACWLPCFLA 275

  Fly   370 YIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK-----KTLKS------LF 423
            .::....|.. ||.:::.:|.|:|||||..||:|:.:|...||.|.:     |..:|      ||
Mouse   276 VLIDPYLDYS-TPIIVLDLLVWLGYFNSTCNPLIHGFFYPWFRKALQFIVSGKIFRSNSDTANLF 339

  Fly   424 PYA 426
            |.|
Mouse   340 PEA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 39/118 (33%)
7tm_1 124..404 CDD:278431 90/281 (32%)
Taar3NP_001008429.1 7tm_4 43..>168 CDD:304433 44/125 (35%)
7tm_1 48..308 CDD:278431 90/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.