DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and Taar7d

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001010838.1 Gene:Taar7d / 435206 MGIID:3527443 Length:358 Species:Mus musculus


Alignment Length:330 Identity:114/330 - (34%)
Similarity:168/330 - (50%) Gaps:43/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGS 177
            :.||..:.|:.||:||:.|::..|:|....|:.|.|||.||.||.:..|.|:....:.|.|.||.
Mouse    53 VFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMPFSMVRSVEGCWYFGE 117

  Fly   178 VMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLP 242
            ..|...:.|:..|..:|:.|||.||||||.|:..||.||...|.......:...||...:.||..
Mouse   118 SYCKFHSCFEGSFCYSSLFHLCFISVDRYIAVSDPLTYPTRFTASVSGKCITFSWLLSIIYSFSL 182

  Fly   243 ICSGWYTTTENYKYLKSNPHI---CEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIY----QEAD 300
            :.:|  ......:.|.|....   |:..||:.:..: :.:.|.||.:||:::|.:|:    |:|.
Mouse   183 LYTG--ANDAGLEDLVSALTCVGGCQIAVNQTWVFI-NFLLFLIPTLVMITVYSKIFLIAKQQAQ 244

  Fly   301 RQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFLICWLP 365
            ..|::   ||..|...|.:       |.|           ..:||||||:||||.::|||:.|||
Mouse   245 NIEKM---SKQTARASESY-------KDR-----------VTKRERKAAKTLGIAVAAFLLSWLP 288

  Fly   366 FFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFK-----KTLK----- 420
            :|:..|:.:.. ..|||..:..||.||.|:|||:||:|||:|...||.|.|     |.|:     
Mouse   289 YFIDSIIDAFL-GFITPTYVYEILVWIVYYNSAMNPLIYAFFYSWFRKAIKLIVSGKILRENSST 352

  Fly   421 -SLFP 424
             :|||
Mouse   353 TNLFP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 44/117 (38%)
7tm_1 124..404 CDD:278431 98/286 (34%)
Taar7dNP_001010838.1 7tm_4 54..>184 CDD:304433 48/129 (37%)
7tm_1 64..326 CDD:278431 98/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.