DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and CG12290

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001287540.1 Gene:CG12290 / 43182 FlyBaseID:FBgn0039419 Length:798 Species:Drosophila melanogaster


Alignment Length:215 Identity:52/215 - (24%)
Similarity:85/215 - (39%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 EKHLQISQIP----KPR-----PSIQVEQSTISTM---RRERKAARTLGIIMSAFLICWLPFFLW 369
            ::|....|||    .|:     .|::...|..|::   |.|.:|||...:::..|::.:|||.|.
  Fly   520 QQHGHALQIPAIHASPKALSYMSSLRHRLSNASSLFKYREESRAARISILVVVMFVVSYLPFGLL 584

  Fly   370 YIVSSLCDSCITPRLLVG--------ILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFPYA 426
            .::.|        ||...        .:|.|...|.: :|.|:||.|:..|    :.:|.||   
  Fly   585 VLLQS--------RLSAANFGGSSQLAIFMILLANLS-SPFIFAYRNKRVR----RGVKRLF--- 633

  Fly   427 FYFCRRGRGRDDDRDLEFGGPSRRGTNGAQRTGSGSAEMANCVNSTASSEIHMSVMRARQYAVN- 490
                    |.|....|:....|...|||.....:..|::..  ||:..|          ||:.| 
  Fly   634 --------GLDSSSGLQRNCSSSVKTNGTAGPAASGAQLQR--NSSKLS----------QYSSNS 678

  Fly   491 ---VTPTTDAQMQQLHPLYT 507
               :||.:....|.  |::|
  Fly   679 CKYLTPQSSLVSQV--PVHT 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433
7tm_1 124..404 CDD:278431 25/106 (24%)
CG12290NP_001287540.1 7tm_1 <190..>305 CDD:278431
7tm_1 <537..617 CDD:278431 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.