DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta1R and mAChR-B

DIOPT Version :9

Sequence 1:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster


Alignment Length:238 Identity:68/238 - (28%)
Similarity:111/238 - (46%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QASEGSTDDADGSSH------------------LALVFVKCFIIGFIILAAILGNMLVIVSVMRH 135
            |:|:|.:..:..||.                  :|:....|.|:      .:.||:||:::.:..
  Fly   103 QSSDGGSTMSGSSSDSEILGPVLPPFALWQTILIAICLAICIIL------TVGGNILVLLAFIVD 161

  Fly   136 RKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCC 200
            |.:|..:|||:.|||..|||:...:|.|....::.|.|..|.::||:|.|.|......|...:..
  Fly   162 RNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLL 226

  Fly   201 ISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICE 265
            |::|||.::.....|....|:.||..|:.:.|:.||||.|:.| .||...|.....|   |..|.
  Fly   227 ITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWIIPALLFFISI-FGWEHFTGKRDLL---PGQCA 287

  Fly   266 FKVNKAYAIVSSSM---SFWIPGIVMLSMYYRIYQEA-DRQER 304
            .:..|. .|.::::   .:|...||:..:|..||:.| |.|:|
  Fly   288 VQFLKD-PIFNTALIIGYYWTTLIVLFVLYAGIYKTAYDMQKR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 36/118 (31%)
7tm_1 124..404 CDD:278431 60/185 (32%)
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 60/185 (32%)
7tm_4 150..>336 CDD:304433 60/185 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.